Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Concizumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Concizumab ELISA Kit

Concizumab ELISA Kit

Product name Concizumab ELISA Kit
Uniprot ID P10646
Raw Antigen Sequence MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIFVKNM
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX171
Note For research use only.
Sample type Plasma, Serum
Target Concizumab
Immunogen Concizumab

Introduction

Concizumab is a novel monoclonal antibody that has shown promising results in the treatment of hemophilia A and B. It targets the tissue factor pathway inhibitor (TFPI) and has the potential to revolutionize the management of these bleeding disorders. To facilitate the detection and quantification of Concizumab, a specialized ELISA kit has been developed. In this article, we will discuss the structure, activity, and application of Concizumab ELISA Kit.

Structure of Concizumab

Concizumab is a humanized monoclonal antibody that was developed using recombinant DNA technology. It is composed of two heavy chains and two light chains, each containing a variable and a constant region. The variable region of the antibody is responsible for binding to its target, TFPI. The constant region, on the other hand, determines the effector functions of the antibody, such as complement activation and antibody-dependent cellular cytotoxicity.

Activity of Concizumab

TFPI is a natural inhibitor of the tissue factor pathway, which is responsible for initiating blood clotting. In hemophilia A and B, there is a deficiency of clotting factors VIII and IX, respectively, leading to impaired blood clotting and excessive bleeding. Concizumab works by binding to TFPI and inhibiting its activity, thereby promoting blood clotting. This mechanism of action makes it a promising therapeutic target for the treatment of hemophilia.

In addition to its role in hemophilia, Concizumab has also shown potential in the treatment of other bleeding disorders, such as acquired hemophilia and hemophilia with inhibitors. It has also been investigated for its potential use in preventing bleeding in patients undergoing surgery or invasive procedures.

Application of Concizumab ELISA Kit

The Concizumab ELISA Kit is a specialized diagnostic tool that enables the detection and quantification of Concizumab in biological samples. It is based on the principle of enzyme-linked immunosorbent assay (ELISA), which utilizes the binding specificity of antibodies to detect and measure the concentration of a specific protein.

The kit contains all the necessary components for performing the ELISA, including pre-coated plates, detection and capture antibodies, and standards for calibration. The procedure involves incubating the sample with the capture antibody, which binds to Concizumab present in the sample. This is followed by the addition of a detection antibody, which binds to a different region of Concizumab. The detection antibody is conjugated with an enzyme, which produces a colorimetric signal upon addition of a substrate. The intensity of the signal is directly proportional to the concentration of Concizumab in the sample.

The Concizumab ELISA Kit has several advantages over other methods of detection, such as Western blotting and immunohistochemistry. It is highly sensitive and specific, allowing for accurate quantification of Concizumab even at low concentrations. It is also a cost-effective and time-efficient method, making it suitable for routine use in clinical and research settings.

Conclusion

In conclusion, Concizumab is a promising therapeutic target for the treatment of hemophilia and other bleeding disorders. The development of a specialized ELISA kit for the detection and quantification of Concizumab has further enhanced its potential by providing a reliable and efficient method for monitoring its levels in biological samples. With ongoing research and clinical trials, Concizumab is poised to revolutionize the management of bleeding disorders and improve the quality of life for patients.

Concizumab ELISA Kit

There are no reviews yet.

Be the first to review “Concizumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products