Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Concizumab Biosimilar – Anti-TFPI mAb – Research Grade

  • PX-TA1306-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: $212.00.Current price is: $167.00.

50ug 21% OFF + 167 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Concizumab Biosimilar - Anti-TFPI mAb - Research Grade
Concizumab Biosimilar - Anti-TFPI mAb - Research Grade binds to TFPI, N-His, recombinant protein in ELISA Assay
Concizumab Biosimilar - Anti-TFPI mAb - Research Grade

Concizumab Biosimilar - Anti-TFPI mAb - Research Grade

Product name Concizumab Biosimilar - Anti-TFPI mAb - Research Grade
Uniprot ID P10646
Source CAS 1312299-39-0
Species Humanized
Raw Antigen Sequence MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIFVKNM
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Concizumab,Anti-TFPI,NN7415,mab2021,TFPI,anti-TFPI
Reference PX-TA1306
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name Concizumab Biosimilar - Anti-TFPI mAb - Research Grade
Uniprot ID P10646
Source CAS 1312299-39-0
Species Humanized
Raw Antigen Sequence MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIFVKNM
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Concizumab,Anti-TFPI,NN7415,mab2021,TFPI,anti-TFPI
Reference PX-TA1306
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name PX-TA1306-50
Uniprot ID P10646
Source CAS 1312299-39-0
Species Humanized
Raw Antigen Sequence MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIFVKNM
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Concizumab,Anti-TFPI,NN7415,mab2021,TFPI,anti-TFPI
Reference PX-TA1306
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

General information on Anti-TFPI[Homo sapiens] (Concizumab) Monoclonal Antibody

Concizumab has been investigated for the treatment of Haemophilia A and Congenital Bleeding Disorder.

SDS-PAGE for Concizumab Biosimilar - Anti-TFPI mAb - Research Grade

SDS-PAGE for Concizumab Biosimilar - Anti-TFPI mAb - Research Grade

Concizumab Biosimilar - Anti-TFPI mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Concizumab Biosimilar - Anti-TFPI mAb - Research Grade binds to TFPI, N-His, recombinant protein in ELISA Assay

Concizumab Biosimilar - Anti-TFPI mAb - Research Grade binds to TFPI, N-His, recombinant protein in ELISA Assay

TFPI, N-His, recombinant protein(cat. No.PX-P5950) at 0.5µg/mL (100µL/well) can bind Concizumab Biosimilar - Anti-TFPI mAb - Research Grade in indirect ELISA with Goat secondary antibody measured by OD450.

Concizumab Biosimilar - Anti-TFPI mAb - Research Grade

There are no reviews yet.

Be the first to review “Concizumab Biosimilar – Anti-TFPI mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products