Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mouse CTLA-4 recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P09793
Molecular weight:
13.75 kDa

$500.00

100ug + 500 loyalty points
Ala37–Asp161 His
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Mouse CTLA-4 recombinant protein

Product name Mouse CTLA-4 recombinant protein
Uniprot ID P09793
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence AIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD
Molecular weight 13.75 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala37-Asp161
Aliases /Synonyms Cd152
Reference PX-P6063
Note For research use only.
Molecular Constructor
Ala37–Asp161 His

Mouse CTLA-4 recombinant protein

There are no reviews yet.

Be the first to review “Mouse CTLA-4 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products