Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Interleukin-4 receptor subunit alpha(IL4R)

Host species:
Mammalian cells
Uniprot ID:
P24394
Molecular weight:
27.3kDa

$250.00

50ug + 250 loyalty points
Met1–His232 His
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Interleukin-4 receptor subunit alpha(IL4R)

Product name Interleukin-4 receptor subunit alpha(IL4R)
Uniprot ID P24394
Uniprot link https://www.uniprot.org/uniprot/P24394
Expression system Eukaryotic expression
Raw Antigen Sequence MGWLCSGLLFPVSCLVLLQVASSGNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQHGSHHHHHH
Molecular weight 27.3kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-His232
Protein Accession P24394
Spec:Entrez GeneID 3566
Spec:NCBI Gene Aliases CD124; IL4RA; IL-4RA
Spec:SwissProtID Q96P01
NCBI Reference P24394
Aliases /Synonyms IL4RA,IL-4 receptor subunit alpha,IL-4R subunit alpha,IL-4R-alpha,IL-4RA,CD_antigen: CD124
Reference PX-P4860
Note For research use only
Molecular Constructor
Met1–His232 His
Product name Interleukin-4 receptor subunit alpha(IL4R)
Uniprot ID P24394
Uniprot link https://www.uniprot.org/uniprot/P24394
Expression system Eukaryotic expression
Raw Antigen Sequence MGWLCSGLLFPVSCLVLLQVASSGNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQHGSHHHHHH
Molecular weight 27.3kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-His232
Protein Accession P24394
Spec:Entrez GeneID 3566
Spec:NCBI Gene Aliases CD124; IL4RA; IL-4RA
Spec:SwissProtID Q96P01
NCBI Reference P24394
Aliases /Synonyms IL4RA,IL-4 receptor subunit alpha,IL-4R subunit alpha,IL-4R-alpha,IL-4RA,CD_antigen: CD124
Reference PX-P4860
Note For research use only
Molecular Constructor
Met1–His232 His

Dupilumab Biosimilar - Anti-IL4R, CD124 mAb binds to Interleukin-4 receptor subunit alpha(IL4R) in indirect ELISA Assay

Dupilumab Biosimilar - Anti-IL4R, CD124 mAb binds to Interleukin-4 receptor subunit alpha(IL4R) in indirect ELISA Assay

Immobilized Interleukin-4 receptor subunit alpha(IL4R) (cat. No.PX-P4860) at 0.5µg/mL (100µL/well) can bind to Dupilumab Biosimilar - Anti-IL4R, CD124 mAb (cat. No.PX-TA1308) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

There are no reviews yet.

Be the first to review “Interleukin-4 receptor subunit alpha(IL4R)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products