Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Rat Resistin-like alpha(Retnla)

Host species:
Mammalian cells
Origin species:
Rattus norvegicus (Rat)
Uniprot ID:
Q99P85
Molecular weight:
35-40kDa

Original price was: $361.00.Current price is: $308.00.

50ug 15% OFF + 308 loyalty points
Met1~Ser111 Fc
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Rat Resistin-like alpha(Retnla)

Product name Rat Resistin-like alpha(Retnla)
Uniprot ID Q99P85
Uniprot link https://www.uniprot.org/uniprot/Q99P85
Origin species Rattus norvegicus (Rat)
Expression system Eukaryotic expression
Raw Antigen Sequence MKTATCSLLICVFLLQLMVPVNTDGTLDIIGKKKVKELLAHQDNYPSAVRKTLSCTNVKSMSKWASCPAGMTATGCSCGFACGSWEIQNENICNCLCLIVDWAYARCCQLS
Molecular weight 35-40kDa
Protein delivered with Tag? C-terminal Fc Tag
Purity estimated >90% by SDS-PAGE
Buffer Tris-glycine
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Ser111
Protein Accession Q99P85
Spec:Entrez GeneID 81712
Spec:NCBI Gene Aliases Himf
NCBI Reference Q99P85
Aliases /Synonyms Fizz1,Cysteine-rich secreted protein FIZZ1,RELMalpha
Reference PX-P4554
Note For research use only
Molecular Constructor
Met1~Ser111 Fc
Product name Rat Resistin-like alpha(Retnla)
Uniprot ID Q99P85
Uniprot link https://www.uniprot.org/uniprot/Q99P85
Origin species Rattus norvegicus (Rat)
Expression system Eukaryotic expression
Raw Antigen Sequence MKTATCSLLICVFLLQLMVPVNTDGTLDIIGKKKVKELLAHQDNYPSAVRKTLSCTNVKSMSKWASCPAGMTATGCSCGFACGSWEIQNENICNCLCLIVDWAYARCCQLS
Molecular weight 35-40kDa
Protein delivered with Tag? C-terminal Fc Tag
Purity estimated >90% by SDS-PAGE
Buffer Tris-glycine
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Ser111
Protein Accession Q99P85
Spec:Entrez GeneID 81712
Spec:NCBI Gene Aliases Himf
NCBI Reference Q99P85
Aliases /Synonyms Fizz1,Cysteine-rich secreted protein FIZZ1,RELMalpha
Reference PX-P4554
Note For research use only
Molecular Constructor
Met1~Ser111 Fc
Product name PX-P4554-1MG
Uniprot ID Q99P85
Uniprot link https://www.uniprot.org/uniprot/Q99P85
Origin species Rattus norvegicus (Rat)
Expression system Eukaryotic expression
Raw Antigen Sequence MKTATCSLLICVFLLQLMVPVNTDGTLDIIGKKKVKELLAHQDNYPSAVRKTLSCTNVKSMSKWASCPAGMTATGCSCGFACGSWEIQNENICNCLCLIVDWAYARCCQLS
Molecular weight 35-40kDa
Protein delivered with Tag? C-terminal Fc Tag
Purity estimated >90% by SDS-PAGE
Buffer Tris-glycine
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Ser111
Protein Accession Q99P85
Spec:Entrez GeneID 81712
Spec:NCBI Gene Aliases Himf
NCBI Reference Q99P85
Aliases /Synonyms Fizz1,Cysteine-rich secreted protein FIZZ1,RELMalpha
Reference PX-P4554
Note For research use only
Molecular Constructor
Met1~Ser111 Fc

Rat Resistin-like alpha(Retnla)

There are no reviews yet.

Be the first to review “Rat Resistin-like alpha(Retnla)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products