Name: Secretory Leukocyte Peptidase Inhibitor (SLPI)
SKU: PX-P4591-10
Availability: InStock

Product name	Secretory Leukocyte Peptidase Inhibitor (SLPI)
Uniprot ID	P97430
Uniprot link	https://www.uniprot.org/uniprot/P97430
Expression system	Prokaryotic expression
Sequence	PWTVEGGKNDAIKIGACPAKKPAQCLKLEKPQCRTDWECPGKQRCCQDACGSKCVNPVPIRKPVWRKPGRCVKTQARCMMLNPPNVCQRDGQCDGKYKCCEGICGKVCLPPM
Molecular weight	12.37 kDa
Protein delivered with Tag?	N-terminal His Tag
Purity estimated	>68% % by SDS-PAGE
Buffer	PBS pH 7.5, 0.02% SKL, 5% Trehalose
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Pro20~Met131
Protein Accession	P97430
Spec:Entrez GeneID	20568
Spec:NCBI Gene Aliases	ALP
Spec:SwissProtID	O09081
NCBI Reference	P97430
Aliases /Synonyms	ALK1; ALP; MPI; BLPI; HUSI; HUSI-I; WAP4; WFDC4
Reference	PX-P4591
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Secretory Leukocyte Peptidase Inhibitor (SLPI)”

Size

Clear

OK

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

PTX17851 189$

View product