Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Secretory Leukocyte Peptidase Inhibitor (SLPI)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P97430
Molecular weight:
12.37 kDa

$469.00

100ug + 469 loyalty points
His Pro20~Met131
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Secretory Leukocyte Peptidase Inhibitor (SLPI)

Secretory Leukocyte Peptidase Inhibitor (SLPI)

Product name Secretory Leukocyte Peptidase Inhibitor (SLPI)
Uniprot ID P97430
Uniprot link https://www.uniprot.org/uniprot/P97430
Expression system Prokaryotic expression
Sequence PWTVEGGKNDAIKIGACPAKKPAQCLKLEKPQCRTDWECPGKQRCCQDACGSKCVNPVPIRKPVWRKPGRCVKTQARCMMLNPPNVCQRDGQCDGKYKCCEGICGKVCLPPM
Molecular weight 12.37 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >68% % by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL, 5% Trehalose
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro20~Met131
Protein Accession P97430
Spec:Entrez GeneID 20568
Spec:NCBI Gene Aliases ALP
Spec:SwissProtID O09081
NCBI Reference P97430
Aliases /Synonyms ALK1; ALP; MPI; BLPI; HUSI; HUSI-I; WAP4; WFDC4
Reference PX-P4591
Note For research use only
Molecular Constructor
His Pro20~Met131
Product name Secretory Leukocyte Peptidase Inhibitor (SLPI)
Uniprot ID P97430
Uniprot link https://www.uniprot.org/uniprot/P97430
Expression system Prokaryotic expression
Sequence PWTVEGGKNDAIKIGACPAKKPAQCLKLEKPQCRTDWECPGKQRCCQDACGSKCVNPVPIRKPVWRKPGRCVKTQARCMMLNPPNVCQRDGQCDGKYKCCEGICGKVCLPPM
Molecular weight 12.37 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >68% % by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL, 5% Trehalose
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro20~Met131
Protein Accession P97430
Spec:Entrez GeneID 20568
Spec:NCBI Gene Aliases ALP
Spec:SwissProtID O09081
NCBI Reference P97430
Aliases /Synonyms ALK1; ALP; MPI; BLPI; HUSI; HUSI-I; WAP4; WFDC4
Reference PX-P4591
Note For research use only
Molecular Constructor
His Pro20~Met131

There are no reviews yet.

Be the first to review “Secretory Leukocyte Peptidase Inhibitor (SLPI)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products