Skip to main content
Contact +1 (919) 234-1277

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Acidic phospholipase A2 CoaPLA2

  • PX-P4330-10
Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q7ZTA7
Molecular weight:
16.94 kDa

$250.00

+ 250 loyalty points
Leu18–Cys139
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Acidic phospholipase A2 CoaPLA2

Acidic phospholipase A2 CoaPLA2

Product name Acidic phospholipase A2 CoaPLA2
Uniprot ID Q7ZTA7
Uniprot link https://www.uniprot.org/uniprot/Q7ZTA7
Expression system Prokaryotic expression
Sequence MGYLLPTAAAGLLLLAAQPAMADLIQFDMMILKVAKRSAMFSYSAYGCYCGWGGHGKPQDPTDRCCLVHDCCYGKVTDCDPKFGSYTYSMNDGALVCGGDDPCKKQVCECDKAAAICFRDNLDTYDYDTYWRFPPKNCLEESEPCGSHHHHHH
Molecular weight 16.94 kDa
Purity estimated /
Buffer 20mMTris-HCl,pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu18-Cys139
Aliases /Synonyms svPLA2,Cvv-E6d,Phosphatidylcholine 2-acylhydrolase
Reference PX-P4330
Note For research use only
Molecular Constructor
Leu18–Cys139
Product name Acidic phospholipase A2 CoaPLA2
Uniprot ID Q7ZTA7
Uniprot link https://www.uniprot.org/uniprot/Q7ZTA7
Expression system Prokaryotic expression
Sequence MGYLLPTAAAGLLLLAAQPAMADLIQFDMMILKVAKRSAMFSYSAYGCYCGWGGHGKPQDPTDRCCLVHDCCYGKVTDCDPKFGSYTYSMNDGALVCGGDDPCKKQVCECDKAAAICFRDNLDTYDYDTYWRFPPKNCLEESEPCGSHHHHHH
Molecular weight 16.94 kDa
Purity estimated /
Buffer 20mMTris-HCl,pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu18-Cys139
Aliases /Synonyms svPLA2,Cvv-E6d,Phosphatidylcholine 2-acylhydrolase
Reference PX-P4330
Note For research use only
Molecular Constructor
Leu18–Cys139

There are no reviews yet.

Be the first to review “Acidic phospholipase A2 CoaPLA2”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products