Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Camalprin Biosimilar – Anti-AAT protein – Research Grade

Origin species:
Human
Uniprot ID:
P01009

Original price was: $205.00.Current price is: $167.00.

50ug 19% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Camalprin Biosimilar - Anti-AAT protein - Research Grade

Product name PX-TA2224-50
Uniprot ID P01009
Source CAS: 2853491-11-7
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-AAT, SPAAT, PI, Alpha-1 protease inhibitor, Alpha-1-antitrypsin, Alpha-1-antiproteinase, SERPINA1, Serpin A1
Reference PX-TA2224-100
Note For research use only. Not suitable for human use.
Isotype Human alpha-1-antitrypsin-variant
Product name Camalprin Biosimilar - Anti-AAT protein - Research Grade
Uniprot ID P01009
Source CAS: 2853491-11-7
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-AAT, SPAAT, PI, Alpha-1 protease inhibitor, Alpha-1-antitrypsin, Alpha-1-antiproteinase, SERPINA1, Serpin A1
Reference PX-TA2224-100
Note For research use only. Not suitable for human use.
Isotype Human alpha-1-antitrypsin-variant
Product name Camalprin Biosimilar - Anti-AAT protein - Research Grade
Uniprot ID P01009
Source CAS: 2853491-11-7
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-AAT, SPAAT, PI, Alpha-1 protease inhibitor, Alpha-1-antitrypsin, Alpha-1-antiproteinase, SERPINA1, Serpin A1
Reference PX-TA2224-100
Note For research use only. Not suitable for human use.
Isotype Human alpha-1-antitrypsin-variant

Introduction

Camalprin Biosimilar is a therapeutic protein that targets the Alpha-1 Antitrypsin (AAT) protein. It is a research grade product that has been developed as a biosimilar to the existing Camalprin medication. In this article, we will discuss the structure, activity, and potential applications of Camalprin Biosimilar in the field of therapeutic protein research.

Structure of Camalprin Biosimilar

Camalprin Biosimilar is a recombinant protein that is produced using advanced biotechnology techniques. It is a glycoprotein with a molecular weight of approximately 52 kDa. The protein is composed of 394 amino acids and has a complex three-dimensional structure that is essential for its activity.

The primary structure of Camalprin Biosimilar is similar to that of the native AAT protein, with minor differences in the amino acid sequence. However, the secondary and tertiary structures of Camalprin Biosimilar are different from the native AAT protein due to the use of different expression systems and post-translational modifications.

Activity of Camalprin Biosimilar

Camalprin Biosimilar is a potent inhibitor of neutrophil elastase, a protease enzyme that is responsible for breaking down proteins in the lungs. It works by binding to and inactivating neutrophil elastase, thereby preventing damage to the lung tissue. This activity is crucial in individuals with Alpha-1 Antitrypsin Deficiency, a genetic disorder that leads to low levels of AAT protein and increased risk of lung diseases such as emphysema and chronic obstructive pulmonary disease (COPD).

In addition to its role in AAT deficiency, Camalprin Biosimilar has also shown promising results in other conditions such as cystic fibrosis, bronchiectasis, and non-cystic fibrosis bronchiolitis. These conditions are characterized by increased levels of neutrophil elastase activity, and Camalprin Biosimilar can help in reducing the damage caused by this enzyme.

Application of Camalprin Biosimilar

Camalprin Biosimilar has a wide range of potential applications in the field of therapeutic protein research. It can be used as a research tool to study the role of AAT protein in various diseases and to develop new treatments for conditions related to AAT deficiency.

Furthermore, Camalprin Biosimilar can also be used in clinical trials to evaluate its efficacy and safety in treating lung diseases. As a biosimilar, it has a similar mechanism of action and activity to the existing Camalprin medication, making it a promising alternative for patients who do not respond well to the current treatment or for those who cannot afford the high cost of the original medication.

Moreover, the production of Camalprin Biosimilar using recombinant technology allows for a consistent and reliable supply of the protein, making it more accessible for research and clinical use.

Conclusion

In conclusion, Camalprin Biosimilar is a research grade therapeutic protein that targets the AAT protein. It has a similar structure and activity to the existing Camalprin medication and has shown promising results in various lung diseases. Its potential applications in research and clinical settings make it a valuable tool in the field of therapeutic protein research. Further studies and clinical trials are needed to fully understand the potential of Camalprin Biosimilar and its role in treating AAT deficiency and related conditions.

There are no reviews yet.

Be the first to review “Camalprin Biosimilar – Anti-AAT protein – Research Grade”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products