Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human APOC3 recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P02656
Molecular weight:
21.30 kDa

$392.00

100ug + 392 loyalty points
Ser21–Ala99 His
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human APOC3 recombinant protein

Human APOC3 recombinant protein

Product name Human APOC3 recombinant protein
Uniprot ID P02656
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA
Molecular weight 21.30 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser21-Ala99
Aliases /Synonyms APOC3, Apolipoprotein C3, Apo-CIII, Apolipoprotein C-III, ApoC-III
Reference PX-P6050
Note For research use only
Molecular Constructor
Ser21–Ala99 His

Human APOC3 recombinant protein

There are no reviews yet.

Be the first to review “Human APOC3 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products