Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DYNLL2 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96FJ2
Molecular weight:
22.56 kDa

Original price was: $322.00.Current price is: $274.00.

50ug 15% OFF + 274 loyalty points
Ser2–Gly89
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DYNLL2 Protein, N-His-SUMO

Product name ARO-P11252-100
Uniprot ID Q96FJ2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Molecular weight 22.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2-Gly89
Aliases /Synonyms Dynein light chain LC8-type 2, DLC2, 8 kDa dynein light chain b, DLC8b, Dynein light chain 2, cytoplasmic, DYNLL2
Reference ARO-P11252
Note For research use only.
Molecular Constructor
Ser2–Gly89
Product name ARO-P11252-1MG
Uniprot ID Q96FJ2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Molecular weight 22.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2-Gly89
Aliases /Synonyms Dynein light chain LC8-type 2, DLC2, 8 kDa dynein light chain b, DLC8b, Dynein light chain 2, cytoplasmic, DYNLL2
Reference ARO-P11252
Note For research use only.
Molecular Constructor
Ser2–Gly89
Product name ARO-P11252-50
Uniprot ID Q96FJ2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Molecular weight 22.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2-Gly89
Aliases /Synonyms Dynein light chain LC8-type 2, DLC2, 8 kDa dynein light chain b, DLC8b, Dynein light chain 2, cytoplasmic, DYNLL2
Reference ARO-P11252
Note For research use only.
Molecular Constructor
Ser2–Gly89

Introduction

Recombinant Human DYNLL2 Protein is a highly purified and biologically active protein that is produced through recombinant DNA technology. This protein is a member of the dynein light chain family and plays a crucial role in various cellular processes such as intracellular transport, cell division, and signaling pathways.

Structure of Recombinant Human DYNLL2 Protein

The recombinant human DYNLL2 protein is a 14 kDa protein consisting of 118 amino acids. It has a highly conserved structure, with 95% sequence identity to its mouse and rat counterparts. The protein is composed of two alpha-helices and a flexible loop in the middle, which is responsible for its binding to various protein partners.

The crystal structure of recombinant human DYNLL2 protein has been determined, revealing the presence of a hydrophobic pocket formed by the two alpha-helices. This pocket serves as the binding site for its interacting partners, making it a crucial protein in many cellular processes.

Activity of Recombinant Human DYNLL2 Protein

Recombinant Human DYNLL2 Protein is a multifunctional protein that plays a crucial role in various cellular processes. One of its main activities is its involvement in intracellular transport processes, where it interacts with the motor protein dynein to facilitate the movement of cellular cargo along microtubules. This activity is essential for the proper functioning of cells, as it ensures the correct distribution of organelles and molecules within the cell.

In addition to its role in intracellular transport, recombinant human DYNLL2 protein also plays a critical role in cell division. It is involved in the formation of the mitotic spindle, which is responsible for the separation of chromosomes during cell division. The protein interacts with other proteins to regulate the dynamics of the mitotic spindle and ensure the accurate distribution of genetic material to daughter cells.

Moreover, recombinant human DYNLL2 protein is also involved in various signaling pathways. It interacts with several proteins, including transcription factors and kinases, to modulate their activity and regulate gene expression. This activity is crucial for the proper functioning and development of cells and tissues.

Application of Recombinant Human DYNLL2 Protein

The unique structure and versatile activity of recombinant human DYNLL2 protein make it a valuable tool for various research applications. One of its main applications is in the study of intracellular transport processes. By using recombinant DYNLL2 protein, researchers can investigate the role of this protein in different transport pathways and its interaction with other proteins involved in these processes.

Recombinant human DYNLL2 protein is also widely used in the study of cell division and mitosis. Its ability to interact with the mitotic spindle and regulate its dynamics makes it a valuable tool for understanding the mechanisms of cell division and its dysregulation in diseases such as cancer.

Furthermore, the involvement of recombinant human DYNLL2 protein in various signaling pathways makes it a valuable tool for studying gene expression and regulation. Its interaction with transcription factors and kinases can provide insights into the complex mechanisms of cellular signaling and its dysregulation in diseases.

Conclusion

In summary, recombinant human DYNLL2 protein is a crucial protein involved in various cellular processes, including intracellular transport, cell division, and signaling pathways. Its unique structure and versatile activity make it a valuable tool for research applications in these areas. The use of recombinant DYNLL2 protein can provide valuable insights into the mechanisms of these processes and their dysregulation in diseases, making it an essential protein in the field of cell biology.

Recombinant Human DYNLL2 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human DYNLL2 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products