Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PPT1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P50897
Molecular weight:
32.90 kDa

Original price was: $400.00.Current price is: $327.00.

100ug 18% OFF + 327 loyalty points
Leu35–Gly306
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PPT1 Protein, N-His

Product name ARO-P11510-100
Uniprot ID P50897
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LVIWHGMGDSCCNPLSMGAIKKMVEKKIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQALAKDPKLQQGYNAMGFSQGGQFLRAVAQRCPSPPMINLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYSKVVQERLVQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLMALKKFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFYAHIIPFLG
Molecular weight 32.90 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu35-Gly306
Aliases /Synonyms PPT-1, Palmitoyl-protein hydrolase 1, CLN1, PPT, PPT1, Palmitoyl-protein thioesterase 1
Reference ARO-P11510
Note For research use only.
Molecular Constructor
Leu35–Gly306
Product name ARO-P11510-1MG
Uniprot ID P50897
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LVIWHGMGDSCCNPLSMGAIKKMVEKKIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQALAKDPKLQQGYNAMGFSQGGQFLRAVAQRCPSPPMINLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYSKVVQERLVQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLMALKKFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFYAHIIPFLG
Molecular weight 32.90 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu35-Gly306
Aliases /Synonyms PPT-1, Palmitoyl-protein hydrolase 1, CLN1, PPT, PPT1, Palmitoyl-protein thioesterase 1
Reference ARO-P11510
Note For research use only.
Molecular Constructor
Leu35–Gly306
Product name ARO-P11510-50
Uniprot ID P50897
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LVIWHGMGDSCCNPLSMGAIKKMVEKKIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQALAKDPKLQQGYNAMGFSQGGQFLRAVAQRCPSPPMINLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYSKVVQERLVQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLMALKKFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFYAHIIPFLG
Molecular weight 32.90 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu35-Gly306
Aliases /Synonyms PPT-1, Palmitoyl-protein hydrolase 1, CLN1, PPT, PPT1, Palmitoyl-protein thioesterase 1
Reference ARO-P11510
Note For research use only.
Molecular Constructor
Leu35–Gly306

Introduction

Recombinant proteins are proteins that are produced through genetic engineering techniques, allowing for the production of large quantities of specific proteins with high purity and activity. These proteins have a wide range of applications in various fields, including medicine, biotechnology, and research. One such protein is Recombinant Human PPT1 Protein, which has gained significant attention for its potential therapeutic applications. In this article, we will discuss the structure, activity, and application of Recombinant Human PPT1 Protein in detail.

Structure of Recombinant Human PPT1 Protein

Recombinant Human PPT1 Protein, also known as Palmitoyl-protein thioesterase 1, is a 306 amino acid long protein that belongs to the palmitoyl-protein thioesterase family. It is encoded by the PPT1 gene located on chromosome 1. The protein contains a conserved catalytic domain, which is essential for its enzymatic activity. The crystal structure of Recombinant Human PPT1 Protein has been determined, revealing a globular structure with a central hydrophobic cavity that accommodates the enzyme’s active site.

Activity of Recombinant Human PPT1 Protein

Recombinant Human PPT1 Protein is a lysosomal enzyme that plays a crucial role in the degradation of lipid-modified proteins. It catalyzes the cleavage of thioester bonds between palmitic acid and cysteine residues in proteins, resulting in the release of free fatty acids and cysteine. This activity is crucial for maintaining the correct levels of palmitoylated proteins in the cell, which are involved in various cellular processes, including intracellular signaling, membrane trafficking, and protein-protein interactions.

Defects in the PPT1 gene, leading to a deficiency of Recombinant Human PPT1 Protein, have been linked to a rare neurodegenerative disorder called Infantile Neuronal Ceroid Lipofuscinosis (INCL). This disorder is characterized by the accumulation of lipofuscin, a pigment made up of lipid-containing residues, in the brain and other tissues. Studies have shown that Recombinant Human PPT1 Protein can effectively reduce the levels of lipofuscin in cells and animal models of INCL, making it a potential therapeutic target for this disorder.

Application of Recombinant Human PPT1 Protein

The potential therapeutic applications of Recombinant Human PPT1 Protein extend beyond INCL. Studies have also shown that this protein can be used to treat other neurodegenerative disorders, such as Alzheimer’s disease and Parkinson’s disease, which are characterized by the accumulation of misfolded proteins in the brain. Recombinant Human PPT1 Protein has been shown to enhance the clearance of these misfolded proteins, thereby reducing their toxic effects on neurons.

In addition, Recombinant Human PPT1 Protein has been investigated for its potential role in cancer therapy. It has been found that this protein can inhibit the growth and proliferation of cancer cells by regulating the levels of palmitoylated proteins involved in cell signaling pathways. This makes it a promising target for the development of novel anti-cancer therapies.

Furthermore, Recombinant Human PPT1 Protein has been utilized in research studies to understand the role of palmitoylation in various cellular processes. Its enzymatic activity has been crucial in identifying and characterizing palmitoylated proteins and their functions, providing valuable insights into the complex mechanisms of cellular signaling and regulation.

Conclusion

Recombinant Human PPT1 Protein is a crucial enzyme with various potential applications in medicine and research. Its structure and activity have been extensively studied, and its therapeutic potential has been demonstrated in various disorders. As research in this field

Recombinant Human PPT1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PPT1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products