Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SSR1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P43307
Molecular weight:
15.49 kDa

Original price was: $299.00.Current price is: $230.00.

50ug 23% OFF + 230 loyalty points
Ser82–Glu198
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SSR1 Protein, N-His

Product name ARO-P11424-100
Uniprot ID P43307
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SADTTILFVKGEDFPANNIVKFLVGFTNKGTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDLNGNVFQDAVFNQTVTVIE
Molecular weight 15.49 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser82-Glu198
Aliases /Synonyms TRAPA, TRAP-alpha, Translocon-associated protein subunit alpha, SSR-alpha, SSR1, Signal sequence receptor subunit alpha
Reference ARO-P11424
Note For research use only.
Molecular Constructor
Ser82–Glu198
Product name ARO-P11424-1MG
Uniprot ID P43307
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SADTTILFVKGEDFPANNIVKFLVGFTNKGTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDLNGNVFQDAVFNQTVTVIE
Molecular weight 15.49 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser82-Glu198
Aliases /Synonyms TRAPA, TRAP-alpha, Translocon-associated protein subunit alpha, SSR-alpha, SSR1, Signal sequence receptor subunit alpha
Reference ARO-P11424
Note For research use only.
Molecular Constructor
Ser82–Glu198
Product name ARO-P11424-50
Uniprot ID P43307
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SADTTILFVKGEDFPANNIVKFLVGFTNKGTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDLNGNVFQDAVFNQTVTVIE
Molecular weight 15.49 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser82-Glu198
Aliases /Synonyms TRAPA, TRAP-alpha, Translocon-associated protein subunit alpha, SSR-alpha, SSR1, Signal sequence receptor subunit alpha
Reference ARO-P11424
Note For research use only.
Molecular Constructor
Ser82–Glu198

Introduction

Recombinant Human SSR1 protein is a type of protein that is produced through genetic engineering techniques. This protein is an important tool in the field of biotechnology, as it has many applications in both research and clinical settings. In this article, we will explore the structure, activity, and applications of Recombinant Human SSR1 Protein.

Structure of Recombinant Human SSR1 Protein

Recombinant Human SSR1 Protein is a member of the superfamily of small cytokines known as chemokines. It is encoded by the CXCL12 gene and is composed of 93 amino acids. The amino acid sequence of this protein is highly conserved among different species, indicating its importance in biological processes.

The structure of Recombinant Human SSR1 Protein is characterized by a three-dimensional fold, with a conserved disulfide bond between cysteine residues at positions 7 and 45. This disulfide bond is essential for the protein’s stability and function. The protein also contains a flexible loop region, which is important for its interaction with other molecules.

Activity of Recombinant Human SSR1 Protein

Recombinant Human SSR1 Protein is a chemokine that plays a crucial role in cell signaling and immune response. It acts as a chemoattractant, meaning it attracts certain types of cells to a specific location. This protein binds to its receptor, CXCR4, on the surface of target cells, triggering a cascade of signaling events that lead to cell migration.

In addition to its role in cell migration, Recombinant Human SSR1 Protein also has other activities. It can stimulate the production of cytokines, which are important molecules involved in inflammation and immune response. It also has anti-inflammatory properties, as it can inhibit the production of pro-inflammatory cytokines.

Applications of Recombinant Human SSR1 Protein

Recombinant Human SSR1 Protein has a wide range of applications in both research and clinical settings. One of its main uses is in cell culture studies, where it is used to study cell migration and immune response. This protein is also used in animal models to study the role of chemokines in various diseases.

In the clinical setting, Recombinant Human SSR1 Protein has been investigated as a potential therapeutic agent for various conditions. It has been shown to have potential in treating inflammatory diseases such as rheumatoid arthritis and multiple sclerosis. It has also been studied as a potential treatment for HIV, as it can block the entry of the virus into cells.

Another important application of Recombinant Human SSR1 Protein is in cancer research. This protein has been found to play a role in tumor growth and metastasis, making it a potential target for cancer treatment. Studies have shown that blocking the interaction between Recombinant Human SSR1 Protein and its receptor can inhibit tumor growth and metastasis.

Conclusion

In conclusion, Recombinant Human SSR1 Protein is a key player in cell signaling and immune response. Its structure, activity, and applications make it an important tool in biotechnology and a potential therapeutic agent for various diseases. Further research on this protein may lead to new insights and treatments for a range of conditions.

Recombinant Human SSR1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human SSR1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products