Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human GFM1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96RP9
Molecular weight:
27.05 kDa

Original price was: $255.00.Current price is: $230.00.

50ug 10% OFF + 230 loyalty points
Arg526–Asn751
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human GFM1 Protein, N-His

Product name ARO-P11188-100
Uniprot ID Q96RP9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RETITAPVPFDFTHKKQSGGAGQYGKVIGVLEPLDPEDYTKLEFSDETFGSNIPKQFVPAVEKGFLDACEKGPLSGHKLSGLRFVLQDGAHHMVDSNEISFIRAGEGALKQALANATLCILEPIMAVEVVAPNEFQGQVIAGINRRHGVITGQDGVEDYFTLYADVPLNDMFGYSTELRSCTEGKGEYTMEYSRYQPCLPSTQEDVINKYLEATGQLPVKKGKAKN
Molecular weight 27.05 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg526-Asn751
Aliases /Synonyms Elongation factor G1, GFM, GFM1, EFG1, mEF-G 1, Elongation factor G, mitochondrial, EF-Gmt, EFG, hEFG1, Elongation factor G 1, mitochondrial
Reference ARO-P11188
Note For research use only.
Molecular Constructor
Arg526–Asn751
Product name ARO-P11188-1MG
Uniprot ID Q96RP9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RETITAPVPFDFTHKKQSGGAGQYGKVIGVLEPLDPEDYTKLEFSDETFGSNIPKQFVPAVEKGFLDACEKGPLSGHKLSGLRFVLQDGAHHMVDSNEISFIRAGEGALKQALANATLCILEPIMAVEVVAPNEFQGQVIAGINRRHGVITGQDGVEDYFTLYADVPLNDMFGYSTELRSCTEGKGEYTMEYSRYQPCLPSTQEDVINKYLEATGQLPVKKGKAKN
Molecular weight 27.05 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg526-Asn751
Aliases /Synonyms Elongation factor G1, GFM, GFM1, EFG1, mEF-G 1, Elongation factor G, mitochondrial, EF-Gmt, EFG, hEFG1, Elongation factor G 1, mitochondrial
Reference ARO-P11188
Note For research use only.
Molecular Constructor
Arg526–Asn751
Product name ARO-P11188-50
Uniprot ID Q96RP9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RETITAPVPFDFTHKKQSGGAGQYGKVIGVLEPLDPEDYTKLEFSDETFGSNIPKQFVPAVEKGFLDACEKGPLSGHKLSGLRFVLQDGAHHMVDSNEISFIRAGEGALKQALANATLCILEPIMAVEVVAPNEFQGQVIAGINRRHGVITGQDGVEDYFTLYADVPLNDMFGYSTELRSCTEGKGEYTMEYSRYQPCLPSTQEDVINKYLEATGQLPVKKGKAKN
Molecular weight 27.05 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg526-Asn751
Aliases /Synonyms Elongation factor G1, GFM, GFM1, EFG1, mEF-G 1, Elongation factor G, mitochondrial, EF-Gmt, EFG, hEFG1, Elongation factor G 1, mitochondrial
Reference ARO-P11188
Note For research use only.
Molecular Constructor
Arg526–Asn751

Introduction

Recombinant Human GFM1 Protein is a synthetic form of the human GFM1 protein, which plays a crucial role in mitochondrial protein synthesis. This protein is encoded by the GFM1 gene and is involved in the elongation phase of protein synthesis in the mitochondria. In this article, we will explore the structure, activity, and applications of Recombinant Human GFM1 Protein.

Structure of Recombinant Human GFM1 Protein

Recombinant Human GFM1 Protein is a 68 kDa protein that is composed of 617 amino acids. It is a member of the translation elongation factor G (EF-G) family and contains three domains: the N-terminal domain, the G domain, and the C-terminal domain. The N-terminal domain is responsible for binding to the ribosome, while the G domain is involved in the hydrolysis of GTP, which is necessary for protein elongation. The C-terminal domain is involved in the interaction with other proteins involved in protein synthesis.

Activity of Recombinant Human GFM1 Protein

Recombinant Human GFM1 Protein plays a crucial role in protein synthesis in the mitochondria. It is involved in the elongation phase, where it facilitates the addition of amino acids to the growing protein chain. This process is essential for the proper functioning of the mitochondria, as it ensures the production of functional proteins that are necessary for cellular respiration and energy production.

The activity of Recombinant Human GFM1 Protein is dependent on the hydrolysis of GTP. When GFM1 binds to the ribosome, it undergoes a conformational change that allows it to hydrolyze GTP. This hydrolysis provides the energy needed for the protein to move along the ribosome and add amino acids to the growing protein chain.

Applications of Recombinant Human GFM1 Protein

Recombinant Human GFM1 Protein has various applications in the field of molecular biology and medicine. Some of the key applications include:

1. Research tool

Recombinant Human GFM1 Protein is widely used as a research tool to study the mechanisms of mitochondrial protein synthesis. Its ability to bind to the ribosome and hydrolyze GTP makes it a valuable tool for studying the elongation phase of protein synthesis.

2. Antigen for antibody production

Recombinant Human GFM1 Protein can be used as an antigen to produce antibodies that specifically target GFM1. These antibodies can be used in various research and diagnostic applications, such as western blotting, immunohistochemistry, and enzyme-linked immunosorbent assays (ELISA).

3. Potential therapeutic target

Mutations in the GFM1 gene have been linked to various mitochondrial diseases, including mitochondrial encephalopathy, lactic acidosis, and stroke-like episodes (MELAS) syndrome. Recombinant Human GFM1 Protein can be used to study these mutations and potentially develop targeted therapies for these diseases.

4. Protein production

Recombinant Human GFM1 Protein can be produced in large quantities using recombinant DNA technology. This protein can then be used in various industrial applications, such as the production of enzymes and other proteins that are essential for cellular processes.

Conclusion

Recombinant Human GFM1 Protein is a crucial component of mitochondrial protein synthesis. Its structure, activity, and applications make it a valuable tool for studying protein synthesis and its role in various diseases. With further research, this protein has the potential to be used as a therapeutic target for mitochondrial diseases and play a significant role in the development of new treatments.

Recombinant Human GFM1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human GFM1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products