Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ARHGDIB Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P52566
Molecular weight:
17.92 kDa

Original price was: $458.00.Current price is: $392.00.

100ug 14% OFF + 392 loyalty points
Asn66–Glu201
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ARHGDIB Protein, N-His

Product name ARO-P11315-100
Uniprot ID P52566
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE
Molecular weight 17.92 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn66-Glu201
Aliases /Synonyms ARHGDIB, Rho-GDI beta, Rho GDP-dissociation inhibitor 2, RAP1GN1, Rho GDI 2, GDIA2, GDID4, Ly-GDI
Reference ARO-P11315
Note For research use only.
Molecular Constructor
Asn66–Glu201
Product name ARO-P11315-1MG
Uniprot ID P52566
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE
Molecular weight 17.92 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn66-Glu201
Aliases /Synonyms ARHGDIB, Rho-GDI beta, Rho GDP-dissociation inhibitor 2, RAP1GN1, Rho GDI 2, GDIA2, GDID4, Ly-GDI
Reference ARO-P11315
Note For research use only.
Molecular Constructor
Asn66–Glu201
Product name ARO-P11315-50
Uniprot ID P52566
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE
Molecular weight 17.92 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn66-Glu201
Aliases /Synonyms ARHGDIB, Rho-GDI beta, Rho GDP-dissociation inhibitor 2, RAP1GN1, Rho GDI 2, GDIA2, GDID4, Ly-GDI
Reference ARO-P11315
Note For research use only.
Molecular Constructor
Asn66–Glu201

Introduction

Recombinant Human ARHGDIB Protein, also known as Rho GDP-dissociation inhibitor 2 (RhoGDI2), is a type of protein that plays a crucial role in regulating the activity of Rho GTPases. Rho GTPases are a family of small G proteins that are involved in various cellular processes, such as cell motility, adhesion, and proliferation. The ARHGDIB protein acts as an inhibitor of Rho GTPases, preventing their activation and subsequent downstream signaling. This protein is produced through recombinant technology, making it a valuable tool for scientific research and potential therapeutic applications.

Structure of Recombinant Human ARHGDIB Protein

The recombinant human ARHGDIB protein is a 23-kDa protein composed of 204 amino acids. It has a conserved RhoGDI domain, which is essential for its function as a Rho GTPase inhibitor. This domain contains a hydrophobic pocket that binds to the prenyl group of Rho GTPases, preventing their interaction with their downstream effectors. Additionally, the ARHGDIB protein also has a C-terminal extension that is unique to this protein and is thought to play a role in its regulation.

Activity of Recombinant Human ARHGDIB Protein

The main function of recombinant human ARHGDIB protein is to inhibit the activity of Rho GTPases. Rho GTPases are activated by the addition of a phosphate group, which allows them to interact with downstream effector proteins and initiate signaling cascades. The ARHGDIB protein binds to the prenyl group of Rho GTPases, preventing their activation and subsequent signaling. This inhibition is reversible, allowing for tight regulation of Rho GTPase activity.

In addition to its role as a Rho GTPase inhibitor, the ARHGDIB protein has also been found to interact with other proteins, such as the EGF receptor and the c-Src tyrosine kinase. These interactions suggest that the ARHGDIB protein may have additional functions beyond Rho GTPase regulation, which require further investigation.

Applications of Recombinant Human ARHGDIB Protein

Recombinant human ARHGDIB protein has a wide range of applications in scientific research. Its ability to inhibit Rho GTPases makes it a valuable tool for studying the role of these proteins in various cellular processes. For example, researchers can use this protein to investigate the effects of Rho GTPase inhibition on cell motility, adhesion, and proliferation. Additionally, the ARHGDIB protein can be used to study the downstream signaling pathways of Rho GTPases and their interactions with other proteins.

Furthermore, the ARHGDIB protein has potential therapeutic applications. As Rho GTPases are involved in various diseases, such as cancer and cardiovascular diseases, the ARHGDIB protein can be used as a potential target for drug development. By inhibiting Rho GTPase activity, the ARHGDIB protein may be able to prevent or treat these diseases. However, further research is needed to fully understand the potential of the ARHGDIB protein as a therapeutic target.

Conclusion

In summary, recombinant human ARHGDIB protein is a valuable tool for scientific research and has potential therapeutic applications. Its structure, activity, and role as a Rho GTPase inhibitor make it a crucial protein in regulating various cellular processes. As research on this protein continues, we may discover new functions and applications for this protein, further expanding our understanding of its role in cellular biology.

Recombinant Human ARHGDIB Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ARHGDIB Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products