Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CD88/C5AR1 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P21730
Molecular weight:
16.19 kDa

Original price was: $294.00.Current price is: $230.00.

50ug 22% OFF + 230 loyalty points
Arg175–Arg206
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CD88/C5AR1 Protein, N-His-SUMO

Product name ARO-P11312-100
Uniprot ID P21730
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RVVREEYFPPKVLCGVDYSHDKRRERAVAIVR
Molecular weight 16.19 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg175-Arg206
Aliases /Synonyms CD88, C5AR1, C5R1, C5AR, C5a-R, C5aR, C5a anaphylatoxin chemotactic receptor 1, C5a anaphylatoxin chemotactic receptor
Reference ARO-P11312
Note For research use only.
Molecular Constructor
Arg175–Arg206
Product name ARO-P11312-1MG
Uniprot ID P21730
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RVVREEYFPPKVLCGVDYSHDKRRERAVAIVR
Molecular weight 16.19 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg175-Arg206
Aliases /Synonyms CD88, C5AR1, C5R1, C5AR, C5a-R, C5aR, C5a anaphylatoxin chemotactic receptor 1, C5a anaphylatoxin chemotactic receptor
Reference ARO-P11312
Note For research use only.
Molecular Constructor
Arg175–Arg206
Product name ARO-P11312-50
Uniprot ID P21730
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RVVREEYFPPKVLCGVDYSHDKRRERAVAIVR
Molecular weight 16.19 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg175-Arg206
Aliases /Synonyms CD88, C5AR1, C5R1, C5AR, C5a-R, C5aR, C5a anaphylatoxin chemotactic receptor 1, C5a anaphylatoxin chemotactic receptor
Reference ARO-P11312
Note For research use only.
Molecular Constructor
Arg175–Arg206

Introduction

Recombinant Human CD88/C5AR1 Protein, also known as C5a receptor 1, is a protein that plays a crucial role in the immune system. It is a member of the G protein-coupled receptor family and is encoded by the C5AR1 gene. This protein is involved in the inflammatory response and is a key mediator of cell migration and activation. In this article, we will discuss the structure, activity, and applications of Recombinant Human CD88/C5AR1 Protein.

Structure of Recombinant Human CD88/C5AR1 Protein

Recombinant Human CD88/C5AR1 Protein is a transmembrane protein consisting of 350 amino acids. It has a molecular weight of approximately 40 kDa. The protein has seven transmembrane domains, an extracellular N-terminus, and an intracellular C-terminus. The extracellular domain contains the ligand-binding site, while the intracellular domain is responsible for signaling.

Activity of Recombinant Human CD88/C5AR1 Protein

Recombinant Human CD88/C5AR1 Protein is a receptor for the complement component C5a. C5a is a small protein that is released during inflammation and acts as a chemoattractant for immune cells. When C5a binds to CD88/C5AR1, it triggers a signaling cascade that leads to the activation of immune cells, such as neutrophils, monocytes, and macrophages. This, in turn, leads to an inflammatory response, which is essential for fighting off infections and promoting tissue repair.

Apart from its role in inflammation, Recombinant Human CD88/C5AR1 Protein also plays a crucial role in cell migration. When immune cells are activated by C5a, they migrate towards the site of infection or injury. This process is essential for the immune system to effectively target and eliminate pathogens.

Applications of Recombinant Human CD88/C5AR1 Protein

Recombinant Human CD88/C5AR1 Protein has various applications in both research and therapeutic settings. One of the main applications of this protein is in the study of the immune system. Researchers use recombinant CD88/C5AR1 protein to understand the role of this receptor in inflammation and cell migration. This knowledge can help in the development of new treatments for inflammatory diseases.

Another application of Recombinant Human CD88/C5AR1 Protein is in drug discovery. As this protein is involved in the inflammatory response, it is a potential target for the development of anti-inflammatory drugs. By studying the structure and activity of CD88/C5AR1, researchers can identify potential drug candidates that can block its function and reduce inflammation.

In therapeutic settings, Recombinant Human CD88/C5AR1 Protein can be used as a diagnostic tool. Elevated levels of C5a and CD88/C5AR1 have been linked to various inflammatory diseases, such as sepsis, rheumatoid arthritis, and asthma. Measuring the levels of these proteins in patient samples can aid in the diagnosis and monitoring of these diseases.

Moreover, Recombinant Human CD88/C5AR1 Protein can also be used as a therapeutic agent itself. In certain diseases, such as sepsis, the inflammatory response can become dysregulated and lead to tissue damage. By targeting CD88/C5AR1, it is possible to modulate the inflammatory response and potentially improve patient outcomes.

Conclusion

Recombinant Human CD88/C5AR1 Protein is a crucial protein involved in the immune response. Its structure and activity play a significant role in inflammation and cell migration. This protein has various applications in research and therapeutics, making it an essential target for further study. By understanding the function of CD88/C5AR1, we can gain valuable insights into the immune system and develop new treatments for inflammatory diseases.

Recombinant Human CD88/C5AR1 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human CD88/C5AR1 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products