Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CD300c, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q08708
Molecular weight:
20.16 kDa

Original price was: $264.00.Current price is: $230.00.

50ug 13% OFF + 230 loyalty points
Gly21–Arg183
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CD300c, N-His

Product name ARO-P13476-100
Uniprot ID Q08708
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR
Molecular weight 20.16 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly21-Arg183
Aliases /Synonyms IgSF16, CD300c, CMRF-35, CMRF35-like molecule 6, CMRF35A1, CMRF35A, CD300C, Immunoglobulin superfamily member 16, IGSF16, CLM-6, CMRF35, CMRF35-A1, CD300 antigen-like family member C
Reference ARO-P13476
Note For research use only.
Molecular Constructor
Gly21–Arg183
Product name ARO-P13476-1MG
Uniprot ID Q08708
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR
Molecular weight 20.16 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly21-Arg183
Aliases /Synonyms IgSF16, CD300c, CMRF-35, CMRF35-like molecule 6, CMRF35A1, CMRF35A, CD300C, Immunoglobulin superfamily member 16, IGSF16, CLM-6, CMRF35, CMRF35-A1, CD300 antigen-like family member C
Reference ARO-P13476
Note For research use only.
Molecular Constructor
Gly21–Arg183
Product name ARO-P13476-50
Uniprot ID Q08708
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR
Molecular weight 20.16 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly21-Arg183
Aliases /Synonyms IgSF16, CD300c, CMRF-35, CMRF35-like molecule 6, CMRF35A1, CMRF35A, CD300C, Immunoglobulin superfamily member 16, IGSF16, CLM-6, CMRF35, CMRF35-A1, CD300 antigen-like family member C
Reference ARO-P13476
Note For research use only.
Molecular Constructor
Gly21–Arg183

Recombinant Human CD300c, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CD300c, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products