Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CFL2 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9Y281
Molecular weight:
30.95 kDa

Original price was: $299.00.Current price is: $230.00.

50ug 23% OFF + 230 loyalty points
Ala2–Leu166
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CFL2 Protein, N-His-SUMO

Product name ARO-P11137-100
Uniprot ID Q9Y281
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL
Molecular weight 30.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Leu166
Aliases /Synonyms CFL2, Cofilin-2, Cofilin, muscle isoform
Reference ARO-P11137
Note For research use only.
Molecular Constructor
Ala2–Leu166
Product name ARO-P11137-1MG
Uniprot ID Q9Y281
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL
Molecular weight 30.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Leu166
Aliases /Synonyms CFL2, Cofilin-2, Cofilin, muscle isoform
Reference ARO-P11137
Note For research use only.
Molecular Constructor
Ala2–Leu166
Product name ARO-P11137-50
Uniprot ID Q9Y281
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL
Molecular weight 30.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Leu166
Aliases /Synonyms CFL2, Cofilin-2, Cofilin, muscle isoform
Reference ARO-P11137
Note For research use only.
Molecular Constructor
Ala2–Leu166

Introduction

Recombinant Human CFL2 Protein is a highly versatile and valuable protein that has been widely used in various scientific research and medical applications. It is a type of recombinant protein, meaning it is produced through genetic engineering techniques, specifically through the manipulation of DNA sequences. This allows for the production of large quantities of the protein in a controlled and efficient manner. In this article, we will explore the structure, activity, and applications of this important protein.

Structure of Recombinant Human CFL2 Protein

The recombinant human CFL2 protein is a member of the cofilin family, which are actin-binding proteins involved in regulating the dynamics of actin filaments. It is composed of 166 amino acids and has a molecular weight of approximately 18.6 kDa. The protein contains two actin-binding sites and a phosphorylation site, which are important for its activity.

The structure of recombinant human CFL2 protein has been extensively studied and determined through various techniques, including X-ray crystallography and nuclear magnetic resonance (NMR) spectroscopy. It has been found to have a similar structure to other cofilin family members, with a central alpha-helical domain and a smaller beta-sheet domain. This structure allows the protein to bind to actin filaments and regulate their dynamics.

Activity of Recombinant Human CFL2 Protein

Recombinant human CFL2 protein is primarily involved in regulating the dynamics of actin filaments, which are essential for various cellular processes such as cell motility, cell division, and cell signaling. The protein binds to actin filaments and promotes their disassembly, leading to the turnover and remodeling of the cytoskeleton. This activity is regulated by the phosphorylation of the protein, which can either enhance or inhibit its binding to actin filaments.

In addition to its role in regulating actin dynamics, recombinant human CFL2 protein has also been found to have other functions. It has been shown to interact with other proteins, such as myosin and tropomyosin, and play a role in muscle contraction. It is also involved in cell migration and invasion, making it a potential target for cancer research.

Applications of Recombinant Human CFL2 Protein

The unique structure and activity of recombinant human CFL2 protein make it a valuable tool for various scientific and medical applications. One of its main applications is in the study of actin dynamics and cytoskeleton regulation. Researchers can use the protein to investigate the mechanisms of actin filament disassembly and its role in different cellular processes.

Recombinant human CFL2 protein has also been used in drug discovery and development. Its involvement in cell migration and invasion makes it a potential target for cancer therapeutics. By studying the protein’s activity and interactions, researchers can identify potential drug candidates that can disrupt its function and inhibit cancer cell growth and metastasis.

Furthermore, recombinant human CFL2 protein has been used in the development of diagnostic tools for certain diseases. For example, it has been shown to be a potential biomarker for Alzheimer’s disease, as its levels have been found to be altered in the brains of patients with this condition. This opens up the possibility of using the protein as a diagnostic tool for early detection and monitoring of the disease.

Conclusion

In summary, recombinant human CFL2 protein is a highly valuable and versatile protein with a unique structure and activity. Its involvement in regulating actin dynamics and other cellular processes makes it a crucial tool for scientific research and medical applications. With ongoing studies and advancements in genetic engineering techniques, the potential uses and benefits of this protein are bound to expand in the future.

Recombinant Human CFL2 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human CFL2 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products