Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DNAJB2 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P25686
Molecular weight:
38.26 kDa

Original price was: $259.00.Current price is: $230.00.

50ug 11% OFF + 230 loyalty points
Ala2–Gly91
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DNAJB2 Protein, N-GST & C-His

Product name ARO-P11373-100
Uniprot ID P25686
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ASYYEILDVPRSASADDIKKAYRRKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKHKREIYDRYGREGLTGTGTGPSRAEAGSGGPG
Molecular weight 38.26 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Gly91
Aliases /Synonyms HSJ-1, Heat shock protein J1, DNAJB2, Heat shock 40 kDa protein 3, DnaJ homolog subfamily B member 2, HSPF3, HSJ1
Reference ARO-P11373
Note For research use only.
Molecular Constructor
Ala2–Gly91
Product name ARO-P11373-1MG
Uniprot ID P25686
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ASYYEILDVPRSASADDIKKAYRRKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKHKREIYDRYGREGLTGTGTGPSRAEAGSGGPG
Molecular weight 38.26 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Gly91
Aliases /Synonyms HSJ-1, Heat shock protein J1, DNAJB2, Heat shock 40 kDa protein 3, DnaJ homolog subfamily B member 2, HSPF3, HSJ1
Reference ARO-P11373
Note For research use only.
Molecular Constructor
Ala2–Gly91
Product name ARO-P11373-50
Uniprot ID P25686
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ASYYEILDVPRSASADDIKKAYRRKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKHKREIYDRYGREGLTGTGTGPSRAEAGSGGPG
Molecular weight 38.26 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Gly91
Aliases /Synonyms HSJ-1, Heat shock protein J1, DNAJB2, Heat shock 40 kDa protein 3, DnaJ homolog subfamily B member 2, HSPF3, HSJ1
Reference ARO-P11373
Note For research use only.
Molecular Constructor
Ala2–Gly91

Introduction

Recombinant Human DNAJB2 Protein, also known as DNAJB2a, is a member of the DNAJ family of proteins that function as co-chaperones in the cellular stress response. This protein is encoded by the DNAJB2 gene and is involved in various cellular processes such as protein folding, degradation, and quality control. Recombinant DNAJB2 Protein is produced through recombinant DNA technology, making it a highly purified and biologically active protein that can be used in various research and therapeutic applications.

Structure of Recombinant Human DNAJB2 Protein

Recombinant Human DNAJB2 Protein is a 37 kDa protein consisting of 347 amino acids. It has a highly conserved J-domain at the N-terminus, which is responsible for its chaperone activity. The J-domain contains a conserved HPD motif that interacts with Hsp70, a major chaperone protein in the cell. This interaction is crucial for the proper functioning of DNAJB2 in the cellular stress response.

Activity of Recombinant Human DNAJB2 Protein

Recombinant Human DNAJB2 Protein is a co-chaperone that plays a critical role in protein folding, degradation, and quality control. It interacts with various chaperone proteins, including Hsp70 and Hsp40, to facilitate the proper folding of newly synthesized proteins and prevent protein aggregation. Moreover, DNAJB2 also functions as a co-chaperone in the degradation of misfolded or damaged proteins through the ubiquitin-proteasome system. This activity is essential for maintaining protein homeostasis and preventing the accumulation of toxic protein aggregates in the cell.

In addition to its chaperone and protein quality control functions, Recombinant Human DNAJB2 Protein also has a role in cellular stress response. It is induced in response to various stressors such as heat shock, oxidative stress, and viral infection. DNAJB2 helps protect cells from stress-induced damage by stabilizing and repairing damaged proteins, thereby promoting cell survival.

Application of Recombinant Human DNAJB2 Protein

Recombinant Human DNAJB2 Protein has a wide range of applications in both research and therapeutic settings. Its ability to interact with chaperone proteins and facilitate protein folding and degradation makes it a valuable tool for studying protein-protein interactions and cellular stress response pathways. Additionally, its role in cellular stress response makes it a potential target for developing therapeutics for various diseases.

One of the major applications of Recombinant Human DNAJB2 Protein is in the study of neurodegenerative diseases. Protein misfolding and aggregation are key features of neurodegenerative diseases such as Alzheimer’s and Parkinson’s. Recombinant DNAJB2 Protein has been shown to inhibit the aggregation of disease-associated proteins and promote their degradation, making it a potential therapeutic target for these diseases.

Moreover, Recombinant Human DNAJB2 Protein has also been studied for its potential role in cancer therapy. It has been shown to inhibit the growth and survival of cancer cells by promoting the degradation of oncoproteins and inducing cell death. This makes it a promising candidate for developing targeted cancer therapies.

In addition to its research applications, Recombinant Human DNAJB2 Protein has also been used in clinical trials for the treatment of certain diseases. For instance, a phase II clinical trial is currently underway to evaluate the efficacy of Recombinant DNAJB2 Protein in treating patients with advanced solid tumors. This highlights the potential of this protein as a therapeutic agent.

Conclusion

Recombinant Human DNAJB2 Protein is a highly purified and biologically active protein that plays a crucial role in protein folding, degradation, and quality control. Its ability to interact with chaperone proteins and facilitate cellular stress response makes it a valuable tool for studying various cellular processes and a potential target for developing therapeutics for diseases such as neurodegenerative disorders and cancer. With ongoing research and clinical trials, the potential of Recombinant Human DNAJB2 Protein in various applications is continuously being explored,

Recombinant Human DNAJB2 Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human DNAJB2 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products