Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SEC22B Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O75396
Molecular weight:
20.39 kDa

Original price was: $501.00.Current price is: $392.00.

100ug 22% OFF + 392 loyalty points
Met1–Gly160
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SEC22B Protein, N-His

Product name ARO-P11932-100
Uniprot ID O75396
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MVLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTELQDVQRIMVANIEEVLQRG
Molecular weight 20.39 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gly160
Aliases /Synonyms ERS-24, SEC22B, SEC22 vesicle-trafficking protein-like 1, SEC22L1, SEC22 vesicle-trafficking protein homolog B, ERS24, ER-Golgi SNARE of 24 kDa, Vesicle-trafficking protein SEC22b
Reference ARO-P11932
Note For research use only.
Molecular Constructor
Met1–Gly160
Product name ARO-P11932-1MG
Uniprot ID O75396
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MVLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTELQDVQRIMVANIEEVLQRG
Molecular weight 20.39 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gly160
Aliases /Synonyms ERS-24, SEC22B, SEC22 vesicle-trafficking protein-like 1, SEC22L1, SEC22 vesicle-trafficking protein homolog B, ERS24, ER-Golgi SNARE of 24 kDa, Vesicle-trafficking protein SEC22b
Reference ARO-P11932
Note For research use only.
Molecular Constructor
Met1–Gly160
Product name ARO-P11932-50
Uniprot ID O75396
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MVLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTELQDVQRIMVANIEEVLQRG
Molecular weight 20.39 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gly160
Aliases /Synonyms ERS-24, SEC22B, SEC22 vesicle-trafficking protein-like 1, SEC22L1, SEC22 vesicle-trafficking protein homolog B, ERS24, ER-Golgi SNARE of 24 kDa, Vesicle-trafficking protein SEC22b
Reference ARO-P11932
Note For research use only.
Molecular Constructor
Met1–Gly160

Introduction

Recombinant Human SEC22B Protein, also known as SEC22 vesicle trafficking protein-like 2, is a protein that plays a crucial role in the transport of proteins and lipids within cells. This protein is encoded by the SEC22B gene and is a member of the SEC22 family of proteins. Recombinant Human SEC22B Protein is a highly conserved protein found in various species, including humans, mice, and rats.

Structure of Recombinant Human SEC22B Protein

The recombinant form of SEC22B protein is produced by cloning the SEC22B gene into an expression vector and expressing it in a suitable host cell. The resulting protein is a 23 kDa protein with a predicted molecular weight of 22,956 Da. It is composed of 199 amino acids and has a predicted isoelectric point of 5.96. The protein has a hydrophobic N-terminal domain, a central coiled-coil domain, and a C-terminal domain that contains a conserved SNARE motif, which is essential for its function.

Activity of Recombinant Human SEC22B Protein

Recombinant Human SEC22B Protein is involved in the vesicular transport of proteins and lipids between different compartments of the cell. It is a member of the SNARE (soluble N-ethylmaleimide-sensitive factor attachment protein receptor) family of proteins, which are responsible for the fusion of transport vesicles with their target membranes. SEC22B specifically plays a role in the transport of vesicles from the endoplasmic reticulum (ER) to the Golgi apparatus, a process crucial for the proper functioning of the secretory pathway.

SEC22B works in conjunction with other SNARE proteins, such as syntaxin-5 and SNAP-23, to form a complex that mediates the fusion of ER-derived vesicles with the Golgi membrane. This process is essential for the delivery of newly synthesized proteins and lipids to their correct destinations within the cell. SEC22B has also been shown to play a role in autophagy, a cellular process involved in the degradation of damaged organelles and proteins.

Applications of Recombinant Human SEC22B Protein

Recombinant Human SEC22B Protein has a wide range of applications in both basic research and clinical settings. Its role in vesicular transport makes it a valuable tool for studying the mechanisms of protein and lipid trafficking within cells. It can also be used to investigate the role of SEC22B in various cellular processes, such as autophagy and secretion.

Furthermore, SEC22B has been implicated in various diseases, including cancer, neurodegenerative disorders, and viral infections. Therefore, recombinant SEC22B protein can also be used in drug discovery and development for these conditions. It can serve as a potential target for therapeutic interventions, and its activity can be modulated using small molecules or antibodies.

Conclusion

In summary, Recombinant Human SEC22B Protein is a crucial protein involved in vesicular transport within cells. Its structure, activity, and applications make it a valuable tool for studying cellular processes and developing therapeutics for various diseases. With further research and development, this protein has the potential to improve our understanding of cell biology and contribute to the development of new treatments for diseases.

Recombinant Human SEC22B Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human SEC22B Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products