Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

STT-5058 Biosimilar – Anti-APOC3 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $224.00.Current price is: $167.00.

50ug 25% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

STT-5058 Biosimilar - Anti-APOC3 mAb - Research Grade

Product name STT-5058 Biosimilar - Anti-APOC3 mAb - Research Grade
Uniprot ID P02656
Source ARGX-116
Species Humanized
Raw Antigen Sequence MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-APOC3, Apolipoprotein C3; Apo-CIII; Apolipoprotein C-III; ApoC-III,ARGX-116
Reference PX-TA1897
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-Kappa
Clonality Monoclonal Antibody
Product name STT-5058 Biosimilar - Anti-APOC3 mAb - Research Grade
Uniprot ID P02656
Source ARGX-116
Species Humanized
Raw Antigen Sequence MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-APOC3, Apolipoprotein C3; Apo-CIII; Apolipoprotein C-III; ApoC-III,ARGX-116
Reference PX-TA1897
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-Kappa
Clonality Monoclonal Antibody
Product name PX-TA1897-50
Uniprot ID P02656
Source ARGX-116
Species Humanized
Raw Antigen Sequence MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-APOC3, Apolipoprotein C3; Apo-CIII; Apolipoprotein C-III; ApoC-III,ARGX-116
Reference PX-TA1897
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction to STT-5058 Biosimilar – Anti-APOC3 mAb

STT-5058 Biosimilar is a novel antibody designed to target and neutralize Apolipoprotein C3 (APOC3), a key regulator of lipid metabolism. This research grade antibody has shown promising results in pre-clinical studies and is being developed as a potential therapeutic for various metabolic disorders. In this article, we will delve into the structure, activity, and potential applications of STT-5058 Biosimilar.

Structure of STT-5058 Biosimilar

STT-5058 Biosimilar is a monoclonal antibody (mAb) that specifically binds to APOC3 with high affinity. It is composed of two identical heavy chains and two identical light chains, connected by disulfide bonds. The heavy chains consist of a variable region (VH) and a constant region (CH), while the light chains contain a variable region (VL) and a constant region (CL). The variable regions of both the heavy and light chains are responsible for binding to APOC3.

Mechanism of Action of STT-5058 Biosimilar

APOC3 is a protein found in the blood that plays a crucial role in regulating triglyceride levels. High levels of APOC3 have been linked to various metabolic disorders, including hypertriglyceridemia, insulin resistance, and cardiovascular diseases. STT-5058 Biosimilar works by binding to APOC3 and preventing its interaction with other proteins involved in lipid metabolism. This leads to a decrease in triglyceride levels and an improvement in metabolic parameters.

Title: Applications of STT-5058 Biosimilar

STT-5058 Biosimilar has shown promising results in pre-clinical studies as a potential therapeutic for various metabolic disorders. It has been shown to effectively reduce triglyceride levels and improve insulin sensitivity in animal models of hypertriglyceridemia and insulin resistance. Additionally, STT-5058 Biosimilar has also shown potential in reducing the risk of cardiovascular diseases by targeting APOC3.

Advantages of STT-5058 Biosimilar

Compared to other APOC3-targeting therapies, STT-5058 Biosimilar has several advantages. Firstly, it is a monoclonal antibody, which allows for high specificity and affinity towards its target. This reduces the risk of off-target effects and increases the efficacy of the therapy. Secondly, STT-5058 Biosimilar is a biosimilar, meaning it is highly similar to the reference product in terms of structure, activity, and efficacy. This allows for a faster and more cost-effective development process.

Future Directions for STT-5058 Biosimilar

The promising results of STT-5058 Biosimilar in pre-clinical studies have led to its advancement into clinical trials. Currently, it is being evaluated in phase 1 and 2 trials for the treatment of hypertriglyceridemia and other metabolic disorders. If successful, STT-5058 Biosimilar has the potential to become a valuable therapeutic option for patients with these conditions.

Conclusion

In summary, STT-5058 Biosimilar is a novel antibody designed to target APOC3, a key regulator of lipid metabolism. Its unique structure and mechanism of action make it a promising therapeutic for various metabolic disorders. With ongoing clinical trials, STT-5058 Biosimilar has the potential to become a valuable addition to the current treatment options for these conditions.

SDS-PAGE for STT-5058 Biosimilar - Anti-APOC3 mAb - Research Grade

SDS-PAGE for STT-5058 Biosimilar - Anti-APOC3 mAb - Research Grade

STT-5058 Biosimilar - Anti-APOC3 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

STT-5058 Biosimilar - Anti-APOC3 mAb - Research Grade

There are no reviews yet.

Be the first to review “STT-5058 Biosimilar – Anti-APOC3 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products