Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Luveltamab Biosimilar – Anti-FOLR1 mAb – Research Grade

  • PX-TA1862-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $425.00.Current price is: $308.00.

50ug 28% OFF + 308 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Luveltamab Biosimilar - Anti-FOLR1 mAb - Research Grade

Product name Luveltamab Biosimilar - Anti-FOLR1 mAb - Research Grade
Uniprot ID P15328
Species Homo Sapiens
Raw Antigen Sequence MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Luveltamab,,FOLR1,anti-FOLR1
Reference PX-TA1862
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Kappa
Clonality Monoclonal Antibody
Product name Luveltamab Biosimilar - Anti-FOLR1 mAb - Research Grade
Uniprot ID P15328
Species Homo Sapiens
Raw Antigen Sequence MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Luveltamab,,FOLR1,anti-FOLR1
Reference PX-TA1862
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Kappa
Clonality Monoclonal Antibody
Product name PX-TA1862-50
Uniprot ID P15328
Species Homo Sapiens
Raw Antigen Sequence MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Luveltamab,,FOLR1,anti-FOLR1
Reference PX-TA1862
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

The Structure of Luveltamab Biosimilar

Luveltamab Biosimilar, also known as Anti-FOLR1 mAb, is a monoclonal antibody that specifically targets the folate receptor 1 (FOLR1). It is a biosimilar version of the original Luveltamab, which was developed by the pharmaceutical company Immunomedics. Luveltamab Biosimilar is a humanized IgG1 antibody, meaning that it is composed of both human and mouse components, making it less likely to elicit an immune response in patients.

The antibody has a molecular weight of approximately 150 kDa and consists of two heavy chains and two light chains. The heavy chains are composed of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains consist of two constant domains (CL) and one variable domain (VL). The variable domains are responsible for binding to the FOLR1 receptor, while the constant domains provide stability and effector functions.

The Activity of Luveltamab Biosimilar

Luveltamab Biosimilar works by binding to the FOLR1 receptor, which is overexpressed in many types of cancer cells. This receptor is essential for the uptake of folate, a vitamin that is crucial for cell growth and division. By targeting FOLR1, Luveltamab Biosimilar inhibits the uptake of folate, leading to decreased cell growth and proliferation.

In addition to blocking folate uptake, Luveltamab Biosimilar also has other mechanisms of action. It can induce antibody-dependent cell-mediated cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC), which are mechanisms by which the immune system can kill cancer cells. Luveltamab Biosimilar has also been shown to inhibit tumor angiogenesis, the process by which tumors develop their own blood supply.

The Application of Luveltamab Biosimilar

Luveltamab Biosimilar is currently being studied for its potential use in the treatment of various types of cancer, including ovarian, lung, and breast cancer. It is also being investigated as a treatment for inflammatory diseases such as rheumatoid arthritis and psoriasis.

In clinical trials, Luveltamab Biosimilar has shown promising results. In a phase II study for ovarian cancer, Luveltamab Biosimilar was well-tolerated and showed a response rate of 31% in patients with FOLR1-positive tumors. In another phase II study for lung cancer, Luveltamab Biosimilar demonstrated a response rate of 38% in patients with FOLR1-positive tumors.

As a research grade antibody, Luveltamab Biosimilar is also widely used in laboratory settings for studying the role of FOLR1 in cancer and other diseases. It can be used in various techniques such as flow cytometry, immunohistochemistry, and Western blotting to detect and quantify FOLR1 expression.

The Future of Luveltamab Biosimilar

With its multiple mechanisms of action and promising results in clinical trials, Luveltamab Biosimilar has the potential to become a valuable treatment option for various types of cancer and inflammatory diseases. As a biosimilar, it also offers a more cost-effective option for patients in need of this targeted therapy.

In the future, Luveltamab Biosimilar may also be studied for its potential use in combination with other cancer treatments, such as chemotherapy and immunotherapy. This could potentially enhance its effectiveness and lead to better outcomes for patients.

In conclusion, Luveltamab Biosimilar, also known as Anti-FOLR1 mAb, is a promising monoclonal antibody with a specific target and multiple mechanisms of action. Its structure, activity, and applications make it a valuable tool for both research and potential therapeutic use in cancer and inflammatory diseases.

Luveltamab Biosimilar - Anti-FOLR1 mAb - Research Grade binds to Recombinant Mouse FOLR1 Protein, N-His in ELISA Assay

Luveltamab Biosimilar - Anti-FOLR1 mAb - Research Grade binds to Recombinant Mouse FOLR1 Protein, N-His in ELISA Assay

Recombinant Mouse FOLR1 Protein, N-His(cat. No.ARO-P10585) at 0.5µg/mL (100µL/well) can bind Luveltamab Biosimilar - Anti-FOLR1 mAb - Research Grade in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Luveltamab Biosimilar - Anti-FOLR1 mAb - Research Grade

SDS-PAGE for Luveltamab Biosimilar - Anti-FOLR1 mAb - Research Grade

Luveltamab Biosimilar - Anti-FOLR1 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Luveltamab Biosimilar - Anti-FOLR1 mAb - Research Grade

There are no reviews yet.

Be the first to review “Luveltamab Biosimilar – Anti-FOLR1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products