Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Farletuzumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Farletuzumab ELISA Kit

Farletuzumab ELISA Kit

Product name Farletuzumab ELISA Kit
Uniprot ID P15328
Raw Antigen Sequence MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX185
Note For research use only.
Sample type Plasma, Serum
Target Farletuzumab
Immunogen Farletuzumab

The Structure of Farletuzumab ELISA Kit

Farletuzumab ELISA Kit is a highly specific and sensitive diagnostic tool used for the detection and quantification of Farletuzumab, a humanized monoclonal antibody. It is composed of a solid-phase microplate coated with a specific antibody against Farletuzumab, along with all the necessary reagents for the detection and measurement of this therapeutic antibody.

The microplate is made of a high-quality plastic material and is divided into multiple wells, each of which is coated with the specific antibody. This antibody is highly specific for Farletuzumab, ensuring that only the target molecule is captured and detected. The kit also contains a series of wash buffers, enzyme-conjugated secondary antibody, and a substrate solution for the detection of the captured Farletuzumab.

The Activity of Farletuzumab ELISA Kit

Farletuzumab ELISA Kit works on the principle of the enzyme-linked immunosorbent assay (ELISA). The microplate is first coated with the specific antibody against Farletuzumab. Then, the sample containing Farletuzumab is added to the wells and allowed to incubate. During this incubation, the Farletuzumab present in the sample binds to the specific antibody on the microplate.

After the incubation, the plate is washed to remove any unbound components. Then, an enzyme-conjugated secondary antibody is added, which binds to the captured Farletuzumab. This enzyme-linked antibody allows for the detection of the bound Farletuzumab.

Finally, a substrate solution is added, which reacts with the enzyme to produce a color change. The intensity of this color is directly proportional to the amount of Farletuzumab present in the sample, and can be measured using a spectrophotometer. This allows for the accurate quantification of Farletuzumab in the sample.

The Application of Farletuzumab ELISA Kit

Farletuzumab ELISA Kit has a wide range of applications in the field of cancer research and therapy. Farletuzumab is a monoclonal antibody that specifically targets the folate receptor alpha (FRα), a protein that is overexpressed in various types of cancer cells. This makes Farletuzumab a potential therapeutic target for these cancers.

The ELISA kit is primarily used for the detection and quantification of Farletuzumab in patient samples. This allows for the monitoring of Farletuzumab levels during treatment, as well as the evaluation of its pharmacokinetics and pharmacodynamics. It can also be used to assess the efficacy of Farletuzumab in clinical trials.

Additionally, the Farletuzumab ELISA Kit can also be used in research studies to investigate the expression and role of FRα in different cancer types. It can also be used to screen potential drugs that target FRα and to study the mechanism of action of Farletuzumab.

In conclusion, Farletuzumab ELISA Kit is a valuable tool for the detection, quantification, and research of Farletuzumab. Its high sensitivity and specificity make it an essential component in the development and evaluation of this therapeutic antibody for the treatment of various types of cancer.

Farletuzumab ELISA Kit

There are no reviews yet.

Be the first to review “Farletuzumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products