Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Farletuzumab Biosimilar – Anti-FOLR1 mAb – Research Grade

  • PX-TA1207-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $200.00.Current price is: $167.00.

50ug 17% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Farletuzumab Biosimilar - Anti-FOLR1 mAb - Research Grade

Product name Farletuzumab Biosimilar - Anti-FOLR1 mAb - Research Grade
Uniprot ID P15328
Source CAS 896723-44-7
Species Humanized
Raw Antigen Sequence MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Molecular weight 30kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Farletuzumab,M3,MORAb-003,FOLR1 ,anti-FOLR1
Reference PX-TA1207
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Farletuzumab Biosimilar - Anti-FOLR1 mAb - Research Grade
Uniprot ID P15328
Source CAS 896723-44-7
Species Humanized
Raw Antigen Sequence MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Molecular weight 30kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Farletuzumab,M3,MORAb-003,FOLR1 ,anti-FOLR1
Reference PX-TA1207
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1207-50
Uniprot ID P15328
Source CAS 896723-44-7
Species Humanized
Raw Antigen Sequence MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Molecular weight 30kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Farletuzumab,M3,MORAb-003,FOLR1 ,anti-FOLR1
Reference PX-TA1207
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Farletuzumab Biosimilar, also known as Anti-FOLR1 mAb, is a monoclonal antibody that has been developed as a potential therapeutic agent for the treatment of various types of cancer. This biosimilar is designed to target the Folate Receptor 1 (FOLR1) protein, which is overexpressed in many cancer cells and plays a crucial role in tumor growth and progression. In this article, we will explore the structure, activity, and potential applications of Farletuzumab Biosimilar in cancer treatment.

Structure of Farletuzumab Biosimilar

Farletuzumab Biosimilar is a recombinant humanized IgG1 monoclonal antibody that specifically binds to the FOLR1 protein. It is composed of two heavy chains and two light chains, each containing variable and constant regions. The variable regions are responsible for binding to the FOLR1 protein, while the constant regions mediate effector functions, such as complement-dependent cytotoxicity and antibody-dependent cellular cytotoxicity. The antibody has a molecular weight of approximately 150 kDa and a half-life of 14 days in humans.

Activity of Farletuzumab Biosimilar

The main mechanism of action of Farletuzumab Biosimilar is through its binding to the FOLR1 protein. This protein is highly expressed on the surface of many cancer cells, including ovarian, lung, breast, and endometrial cancer cells. By binding to FOLR1, Farletuzumab Biosimilar blocks the interaction of the protein with its ligand, folate, which is essential for tumor growth and survival. This leads to decreased proliferation and increased apoptosis of cancer cells, ultimately inhibiting tumor growth.

Moreover, Farletuzumab Biosimilar has been shown to enhance the activity of chemotherapy drugs, such as paclitaxel and carboplatin, in cancer cells that overexpress FOLR1. This is due to the fact that the antibody can increase the uptake of these drugs into cancer cells, resulting in higher efficacy and lower toxicity.

Applications of Farletuzumab Biosimilar

Farletuzumab Biosimilar is currently being investigated as a potential treatment for various types of cancer, including ovarian, lung, breast, and endometrial cancer. In preclinical studies, the antibody has shown promising results in inhibiting tumor growth and improving the efficacy of chemotherapy drugs in these cancers.

In clinical trials, Farletuzumab Biosimilar has been evaluated as a monotherapy and in combination with chemotherapy in patients with advanced ovarian cancer. Although the results have been mixed, with some studies showing a modest improvement in progression-free survival, the overall response rate and overall survival have not been significantly improved. However, further studies are needed to fully assess the efficacy of this biosimilar in ovarian cancer.

In addition to ovarian

cancer, Farletuzumab Biosimilar is also being investigated in other types of cancer, such as lung and breast cancer. In a phase II clinical trial, the combination of Farletuzumab Biosimilar and chemotherapy showed promising results in patients with advanced lung cancer, with an overall response rate of 52%. Similarly, in a phase I/II study, the combination of the antibody and chemotherapy showed encouraging results in patients with metastatic breast cancer.

Conclusion

In summary, Farletuzumab Biosimilar is a promising monoclonal antibody that specifically targets the FOLR1 protein, which is overexpressed in many types of cancer. Its main mechanism of action involves blocking the interaction of FOLR1 with folate, leading to decreased proliferation and increased apoptosis of cancer cells. This biosimilar has shown potential in improving the efficacy of chemotherapy drugs in preclinical and clinical studies, and further research is needed to fully assess its therapeutic potential in various types of cancer.

SDS-PAGE for Farletuzumab Biosimilar - Anti-FOLR1 mAb - Research Grade

SDS-PAGE for Farletuzumab Biosimilar - Anti-FOLR1 mAb - Research Grade

Farletuzumab Biosimilar - Anti-FOLR1 mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Farletuzumab Biosimilar - Anti-FOLR1 mAb binds to FOLR1 recombinant protein in indirect ELISA Assay

Farletuzumab Biosimilar - Anti-FOLR1 mAb binds to FOLR1 recombinant protein in indirect ELISA Assay

Immobilized FOLR1 recombinant protein (cat. No.PX-P5197) at 0.5µg/mL (100µL/well) can bind to Farletuzumab Biosimilar - Anti-FOLR1 mAb (cat. No.PX-TA1207) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Farletuzumab Biosimilar - Anti-FOLR1  mAb - Research Grade

There are no reviews yet.

Be the first to review “Farletuzumab Biosimilar – Anti-FOLR1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products