Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Nesvacumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Nesvacumab ELISA Kit

Nesvacumab ELISA Kit

Product name Nesvacumab ELISA Kit
Uniprot ID O15123
Raw Antigen Sequence MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX117
Note For research use only.
Sample type Plasma, Serum
Target Nesvacumab
Immunogen Nesvacumab

Introduction to Nesvacumab ELISA Kit

Nesvacumab ELISA Kit is a highly sensitive and specific diagnostic tool used for the detection and quantification of Nesvacumab in biological samples. This kit is designed for use in research and clinical settings to aid in the study of Nesvacumab, a novel therapeutic target for various diseases.

Structure of Nesvacumab

Nesvacumab is a human monoclonal antibody that specifically binds to and inhibits the activity of vascular endothelial growth factor (VEGF). It is composed of two heavy chains and two light chains, with a molecular weight of approximately 150 kDa. The antibody has a unique binding site that recognizes and binds to VEGF, preventing its interaction with its receptors and inhibiting its downstream signaling pathways.

Activity of Nesvacumab

The primary activity of Nesvacumab is its ability to inhibit VEGF, a key mediator of angiogenesis and vascular permeability. Inhibition of VEGF prevents the growth and proliferation of new blood vessels, which is essential for the development and progression of various diseases such as cancer, age-related macular degeneration, and diabetic retinopathy. Nesvacumab also reduces vascular permeability, which can help in the treatment of diseases associated with abnormal blood vessel leakage, such as diabetic macular edema.

In addition to its anti-angiogenic and anti-permeability effects, Nesvacumab has also been shown to have anti-inflammatory properties. It can reduce the production of pro-inflammatory cytokines and chemokines, thereby reducing inflammation and tissue damage in various diseases.

Application of Nesvacumab ELISA Kit

Nesvacumab ELISA Kit is a valuable tool for researchers and clinicians studying Nesvacumab and its potential therapeutic applications. The kit can be used to detect and quantify Nesvacumab levels in biological samples, such as serum, plasma, and cell culture supernatants. This allows for the monitoring of Nesvacumab levels in patients receiving treatment, as well as the evaluation of its pharmacokinetics and pharmacodynamics.

The kit can also be used to measure the levels of Nesvacumab in preclinical studies, aiding in the development and optimization of treatment protocols. Furthermore, the kit can be used to screen for potential drug-drug interactions and assess the impact of concomitant medications on Nesvacumab levels.

Moreover, Nesvacumab ELISA Kit can be used in the diagnosis and prognosis of diseases associated with abnormal VEGF levels. By quantifying Nesvacumab, the kit can provide valuable information about the activity of VEGF and its potential role in the development and progression of diseases such as cancer and retinal disorders.

Conclusion

Nesvacumab ELISA Kit is a powerful tool for the detection and quantification of Nesvacumab, a novel therapeutic target with potential applications in various diseases. Its high sensitivity and specificity make it a valuable asset for researchers and clinicians studying Nesvacumab and its role in disease pathogenesis and treatment. With its multiple applications and potential for further research, Nesvacumab ELISA Kit is a valuable addition to the arsenal of tools available for studying and targeting VEGF and its associated diseases.

Nesvacumab ELISA Kit

There are no reviews yet.

Be the first to review “Nesvacumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products