Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tocilizumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Tocilizumab ELISA Kit

Tocilizumab ELISA Kit

Product name Tocilizumab ELISA Kit
Uniprot ID P08887
Raw Antigen Sequence MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX164
Note For research use only.
Sample type Plasma, Serum
Target Tocilizumab
Immunogen Tocilizumab

Introduction

Tocilizumab is a humanized monoclonal antibody that specifically binds to the interleukin-6 (IL-6) receptor. It is used as a therapeutic agent in the treatment of various inflammatory conditions such as rheumatoid arthritis, giant cell arteritis, and cytokine release syndrome. The Tocilizumab ELISA Kit is a useful tool for the detection and quantification of Tocilizumab in various biological samples. In this article, we will discuss the structure, activity, and applications of the Tocilizumab ELISA Kit.

Structure of Tocilizumab

Tocilizumab is a 148 kDa humanized IgG1 monoclonal antibody. It is composed of two heavy chains and two light chains, each containing a variable and constant region. The variable region of Tocilizumab is responsible for its specific binding to the IL-6 receptor. The constant region is responsible for the effector functions of the antibody, such as complement activation and antibody-dependent cellular cytotoxicity.

Activity of Tocilizumab

Tocilizumab exerts its therapeutic effects by blocking the binding of IL-6 to its receptor. IL-6 is a pro-inflammatory cytokine that plays a crucial role in the pathogenesis of various inflammatory diseases. By binding to the IL-6 receptor, Tocilizumab prevents the activation of downstream signaling pathways, thereby reducing the production of inflammatory mediators. This leads to a decrease in inflammation and alleviation of symptoms in patients with inflammatory conditions.

Application of Tocilizumab ELISA Kit

The Tocilizumab ELISA Kit is a valuable tool for the detection and quantification of Tocilizumab in various biological samples. It is commonly used in research and clinical settings to monitor Tocilizumab levels in patients undergoing treatment. The kit utilizes a sandwich ELISA method, where Tocilizumab is captured by a specific anti-Tocilizumab antibody coated on the plate and then detected using a secondary antibody conjugated to an enzyme. The amount of Tocilizumab present in the sample is directly proportional to the intensity of the color produced, which can be measured using a spectrophotometer.

Research Applications

In research, the Tocilizumab ELISA Kit is used to study the pharmacokinetics and pharmacodynamics of Tocilizumab. It allows for the measurement of Tocilizumab levels in different biological samples, such as serum, plasma, and synovial fluid. This helps researchers understand the distribution, metabolism, and elimination of Tocilizumab in the body. The kit also aids in the evaluation of the efficacy of Tocilizumab in different disease models.

Clinical Applications

In clinical settings, the Tocilizumab ELISA Kit is used to monitor Tocilizumab levels in patients with inflammatory conditions. It allows for the optimization of Tocilizumab dosing and the assessment of treatment response. The kit is also useful in detecting the presence of anti-Tocilizumab antibodies, which can potentially reduce the efficacy of the drug.

Limitations of Tocilizumab ELISA Kit

Although the Tocilizumab ELISA Kit is a reliable tool for the detection and quantification of Tocilizumab, it has some limitations. The kit may cross-react with other anti-IL-6 receptor antibodies, leading to false-positive results. It is also important to note that the kit does not differentiate between active and inactive forms of Tocilizumab, which can affect the interpretation of results.

Conclusion The Tociliz

Tocilizumab ELISA Kit

There are no reviews yet.

Be the first to review “Tocilizumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products