Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Faricimab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Faricimab ELISA Kit

Faricimab ELISA Kit

Product name Faricimab ELISA Kit
Uniprot ID P15692 & O15123
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX116
Note For research use only.
Sample type Plasma, Serum
Target Faricimab
Immunogen Faricimab

Introduction

The Faricimab ELISA Kit is a highly sensitive and specific diagnostic tool used for the detection and quantification of Faricimab, a novel therapeutic antibody. This kit is designed for use in research laboratories and clinical settings to aid in the development and evaluation of Faricimab-based therapies. In this article, we will discuss the structure, activity, and application of the Faricimab ELISA Kit in detail.

Structure of Faricimab ELISA Kit

The Faricimab ELISA Kit is composed of several components including microtiter plates, Faricimab-specific antibodies, and detection reagents. The microtiter plates are coated with a highly specific capture antibody that binds to Faricimab present in the sample. The detection antibody, labeled with a reporter enzyme, is then added to the plate and binds to the captured Faricimab. Finally, a substrate solution is added which produces a color change in the presence of the reporter enzyme, indicating the presence of Faricimab in the sample.

Activity of Faricimab ELISA Kit

The Faricimab ELISA Kit is based on the principle of enzyme-linked immunosorbent assay (ELISA) which is a commonly used technique for the detection and quantification of various biomolecules. In this kit, the specific antibodies are used to capture and detect Faricimab, making it a highly sensitive and specific diagnostic tool. The detection reagents, including the reporter enzyme and substrate, amplify the signal, allowing for the accurate quantification of Faricimab in the sample.

Application of Faricimab ELISA Kit

The Faricimab ELISA Kit has a wide range of applications in both research and clinical settings. It can be used to measure the levels of Faricimab in biological samples such as serum, plasma, and cell culture supernatants. This makes it a valuable tool for monitoring the pharmacokinetics and pharmacodynamics of Faricimab-based therapies. Additionally, the Faricimab ELISA Kit can be used to screen for potential therapeutic candidates that target Faricimab.

Furthermore, the Faricimab ELISA Kit can also be used in diagnostic applications to aid in the diagnosis and management of diseases related to Faricimab, such as age-related macular degeneration and diabetic macular edema. The accurate quantification of Faricimab in patient samples can provide valuable information for disease prognosis and treatment response.

Conclusion

The Faricimab ELISA Kit is a powerful tool for the detection and quantification of Faricimab, a novel therapeutic antibody. Its highly sensitive and specific nature makes it a valuable asset in both research and clinical settings. With its wide range of applications, the Faricimab ELISA Kit has the potential to contribute to the development and evaluation of Faricimab-based therapies, as well as aid in the diagnosis and management of related diseases.

Faricimab ELISA Kit

There are no reviews yet.

Be the first to review “Faricimab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products