Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Olokizumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Olokizumab ELISA Kit

Olokizumab ELISA Kit

Product name Olokizumab ELISA Kit
Uniprot ID P05231
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX150
Note For research use only.
Sample type Plasma, Serum
Target Olokizumab
Immunogen Olokizumab

Olokizumab ELISA Kit: Structure, Activity and Application Olokizumab ELISA Kit: Structure, Activity and Application Introduction

Olokizumab is a humanized monoclonal antibody that has been developed as a potential therapeutic agent for the treatment of inflammatory diseases. It specifically targets the interleukin-6 (IL-6) cytokine, which plays a crucial role in the pathogenesis of various autoimmune and inflammatory conditions. Olokizumab ELISA Kit is a highly sensitive and specific tool for the quantitative measurement of olokizumab in various biological samples. In this article, we will discuss the structure, activity, and application of the Olokizumab ELISA Kit.

Structure of Olokizumab

Olokizumab is a recombinant humanized IgG4 monoclonal antibody with a molecular weight of approximately 150 kDa. It is composed of two identical heavy chains and two identical light chains, each consisting of approximately 450 amino acids. The antibody has a typical Y-shaped structure, with two antigen-binding fragments (Fab) and one crystallizable fragment (Fc). The Fab region is responsible for binding to the target antigen, while the Fc region mediates effector functions such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC).

Mechanism of Action

Olokizumab exerts its therapeutic effect by specifically binding to the IL-6 cytokine and blocking its interaction with its receptor, IL-6R. This prevents the activation of downstream signaling pathways, thereby inhibiting the production of pro-inflammatory cytokines and chemokines. In addition, olokizumab also induces the internalization and degradation of IL-6R, further reducing the availability of functional receptors on the cell surface.

Application of Olokizumab ELISA Kit

The Olokizumab ELISA Kit is a valuable tool for the quantitative measurement of olokizumab in various biological samples, including serum, plasma, and cell culture supernatants. It utilizes a sandwich ELISA format, in which the olokizumab present in the sample is captured by a specific anti-olokizumab antibody coated on the microplate wells. After washing away any unbound substances, a secondary anti-olokizumab antibody conjugated with an enzyme is added, followed by a substrate that produces a colorimetric signal. The intensity of the signal is directly proportional to the amount of olokizumab present in the sample, and can be quantified using a spectrophotometer.

Sensitivity and Specificity

The Olokizumab ELISA Kit has a sensitivity of <0.1 ng/mL, making it highly sensitive for the detection of olokizumab. It also has a high specificity, with minimal cross-reactivity with other related antibodies or proteins.

Advantages of Olokizumab ELISA Kit

  • Highly sensitive and specific
  • Simple and rapid procedure
  • Can be used for both qualitative and quantitative analysis
  • Can be used with various sample types
  • Cost-effective compared to other detection methods

Clinical Applications The Olokizumab ELISA Kit has several clinical applications, including:

  • Monitoring olokizumab levels in patients receiving treatment for inflammatory diseases
  • Pharmacokinetic studies to assess the absorption, distribution, metabolism

Olokizumab ELISA Kit

There are no reviews yet.

Be the first to review “Olokizumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products