Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Faricimab Biosimilar – Anti-ANGPT2, VEGFA mAb – Research Grade

  • PX-TA1501-100UG
  • Validated ELISA
Isotype:
IgG1 Kappa, IgG1 Lambda

Original price was: $288.00.Current price is: $238.00.

100ug 17% OFF + 238 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Faricimab Biosimilar - Anti-ANGPT2, VEGFA mAb - Research Grade

Product name Faricimab Biosimilar - Anti-ANGPT2, VEGFA mAb - Research Grade
Uniprot ID P15692 & O15123
Source CAS 1607793-29-2
Species Humanized
Expression system Mammalian
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Faricimab,RG7716,RO6867461,ANGPT2, VEGFA,anti-ANGPT2, VEGFA
Reference PX-TA1501
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa-lambda
Clonality Monoclonal Antibody
Product name Faricimab Biosimilar - Anti-ANGPT2, VEGFA mAb - Research Grade
Uniprot ID P15692 & O15123
Source CAS 1607793-29-2
Species Humanized
Expression system Mammalian
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Faricimab,RG7716,RO6867461,ANGPT2, VEGFA,anti-ANGPT2, VEGFA
Reference PX-TA1501
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa-lambda
Clonality Monoclonal Antibody
Product name PX-TA1501-50
Uniprot ID P15692 & O15123
Source CAS 1607793-29-2
Species Humanized
Expression system Mammalian
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Faricimab,RG7716,RO6867461,ANGPT2, VEGFA,anti-ANGPT2, VEGFA
Reference PX-TA1501
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Kappa, IgG1 Lambda

About Faricimab biosimilar

Faricimab is a bispecific monoclonal antibody. This antibody is especially part of the human immunoglobulin G1-kappa-lambda type. It is targeting angiopoetin 2 (ANGPT2) and Vascular Endothelial Growth factor A (VEGFA). Both of these factors play key roles in angiogenesis and endothelial development respectively. Angiopoetin 2 is essential for normal vascular development as VEGF-A, which is an endothelial cell mitogen. Angiopoetin 2 is involved especially in vascular morphogenesis and homeostasis, and is mostly expressed in endothelial cells.
The expression of VEGF-A is shown to be up regulated in inflamed and vascularized human corneas. VEGF-A is therefore a target of choice to treat patients with retinal vascular diseases such as a retinal vein occlusion, Age related macular degeneration (AMD) and diabetic macular edema. Indeed, these diseases are caused by retinal ischemia and subsequent neovascularization.

A research grade biosimilar

Faricimab biosimilar is a humanized antibody based on on cross Mab technology. It is produced in mammalian cell line (Chinese Hamster Ovary -CHO) using a recombinant DNA technology. Proteogenix offer a product for research use only, not suitable for clinical or therapeutic use.

Faricimab Biosimilar - Anti-ANGPT2, VEGFA mAb binds to Human ANGPT2 in indirect ELISA Assay

Faricimab Biosimilar - Anti-ANGPT2, VEGFA mAb binds to Human ANGPT2 in indirect ELISA Assay

Immobilized Human ANGPT2-Ang2 recombinant protein (cat. No.PX-P6245) at 0.5µg/mL (100µL/well) can bind Faricimab Biosimilar - Anti-ANGPT2, VEGFA mAb (cat. No.PX-TA1501) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 66.43M.

SDS-PAGE for Faricimab Biosimilar - Anti-ANGPT2, VEGFA mAb

SDS-PAGE for Faricimab Biosimilar - Anti-ANGPT2, VEGFA mAb

Faricimab Biosimilar - Anti-ANGPT2, VEGFA mAb, on SDS-PAGE under non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Faricimab Biosimilar - Anti-ANGPT2, VEGFA mAb - Research Grade

There are no reviews yet.

Be the first to review “Faricimab Biosimilar – Anti-ANGPT2, VEGFA mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products