Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human ANGPT2-Ang2 recombinant protein

  • PX-P6245
  • Validated ELISA
Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
O15123
Molecular weight:
83.24 kDa

$500.00

100ug + 500 loyalty points
Tyr19–Phe496 Fc
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human ANGPT2-Ang2 recombinant protein

Product name Human ANGPT2-Ang2 recombinant protein
Uniprot ID O15123
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence YNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF
Molecular weight 83.24 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Purity estimated >85% by SDS-PAGE
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Tyr19-Phe496
Aliases /Synonyms Angiopoietin-2, ANG-2, ANGPT2
Reference PX-P6245
Note For research use only
Molecular Constructor
Tyr19–Phe496 Fc

Human ANGPT2-Ang2 recombinant protein binds to Faricimab Biosimilar - Anti-ANGPT2, VEGFA mAb in indirect ELISA Assay

Human ANGPT2-Ang2 recombinant protein binds to Faricimab Biosimilar - Anti-ANGPT2, VEGFA mAb in indirect ELISA Assay

Immobilized Human ANGPT2-Ang2 recombinant protein (cat. No.PX-P6245) at 0.5µg/mL (100µL/well) can bind Faricimab Biosimilar - Anti-ANGPT2, VEGFA mAb (cat. No.PX-TA1501) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 66.43M.

Vanucizumab Biosimilar - Anti-ANGPT2, VEGFA, mAb binds to Human ANGPT2 in indirect ELISA Assay

Vanucizumab Biosimilar - Anti-ANGPT2, VEGFA, mAb binds to Human ANGPT2 in indirect ELISA Assay

Immobilized Human ANGPT2-Ang2 recombinant protein (cat. No.PX-P6245) at 0.5µg/mL (100µL/well) can bind Vanucizumab Biosimilar - Anti-ANGPT2, VEGFA, mAb (cat. No.PX-TA1355) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 105.6M.

Human ANGPT2-Ang2 recombinant protein

There are no reviews yet.

Be the first to review “Human ANGPT2-Ang2 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products