Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Cibisatamab Biosimilar – Anti-CEACAM5&CD3E;CD3E mAb – Research Grade

  • PX-TA1824-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1 Kappa; IgG1 Lambda

Original price was: $226.00.Current price is: $167.00.

50ug 26% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Cibisatamab Biosimilar - Anti-CEACAM5&CD3E;CD3E mAb - Research Grade

Product name Cibisatamab Biosimilar - Anti-CEACAM5&CD3E;CD3E mAb - Research Grade
Uniprot ID P06731 & P07766
Species Bispecific mAb with Domain Crossover
Raw Antigen Sequence MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Cibisatamab,,CEACAM5&CD3E;CD3E,anti-CEACAM5&CD3E;CD3E
Reference PX-TA1824
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Kappa; IgG1 Lambda
Clonality Monoclonal Antibody
Product name Cibisatamab Biosimilar - Anti-CEACAM5&CD3E;CD3E mAb - Research Grade
Uniprot ID P06731 & P07766
Species Bispecific mAb with Domain Crossover
Raw Antigen Sequence MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Cibisatamab,,CEACAM5&CD3E;CD3E,anti-CEACAM5&CD3E;CD3E
Reference PX-TA1824
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Kappa; IgG1 Lambda
Clonality Monoclonal Antibody
Product name PX-TA1824-50
Uniprot ID P06731 & P07766
Species Bispecific mAb with Domain Crossover
Raw Antigen Sequence MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Cibisatamab,,CEACAM5&CD3E;CD3E,anti-CEACAM5&CD3E;CD3E
Reference PX-TA1824
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Kappa; IgG1 Lambda
Clonality Monoclonal Antibody

Introduction to Cibisatamab Biosimilar – A Novel Antibody Targeting CEACAM5&CD3E for

Cancer Treatment

Cibisatamab Biosimilar, also known as Anti-CEACAM5&CD3E,CD3E mAb – Research Grade, is a novel antibody that has shown promising results in cancer treatment. This biosimilar is designed to target two specific proteins, CEACAM5 and CD3E, which are known to play a crucial role in cancer development and progression. In this article, we will provide a detailed scientific description of the structure, activity, and potential applications of Cibisatamab Biosimilar.

Structure of Cibisatamab Biosimilar

Cibisatamab Biosimilar is a monoclonal antibody, which means it is derived from a single type of immune cell. It is a chimeric antibody, meaning it is composed of both human and mouse parts. The antibody is composed of two main regions – the Fab region and the Fc region. The Fab region is responsible for binding to the target proteins, while the Fc region is involved in immune system activation.

Activity of Cibisatamab Biosimilar

Cibisatamab Biosimilar is designed to target two proteins, CEACAM5 and CD3E. CEACAM5, also known as carcinoembryonic antigen-related cell adhesion molecule 5, is a cell surface protein that is overexpressed in many types of cancer, including colorectal, lung, and breast cancer. CD3E, on the other hand, is a protein found on the surface of T cells, a type of immune cell that plays a crucial role in fighting cancer.

When Cibisatamab Biosimilar binds to CEACAM5, it blocks the function of this protein, which is known to promote tumor growth and spread. At the same time, the antibody binds to CD3E, activating T cells and enhancing their ability to kill cancer cells. This dual mechanism of action makes Cibisatamab Biosimilar a potent anti- cancer agent.

Applications of Cibisatamab Biosimilar

Cibisatamab Biosimilar is currently being studied as a potential treatment for various types of cancer, including colorectal, lung, and breast cancer. It has shown promising results in preclinical studies and is now being evaluated in clinical trials. In a phase I clinical trial, Cibisatamab Biosimilar has shown promising anti-tumor activity in patients with advanced colorectal cancer. It has also been shown to have a favorable safety profile, with no serious adverse events reported.

In addition to its potential as a standalone therapy, Cibisatamab Biosimilar is also being studied in combination with other anti- cancer agents. For example, it is being evaluated in combination with chemotherapy in patients with advanced colorectal cancer. This combination therapy has shown promising results in preclinical studies and is now being evaluated in clinical trials.

Conclusion

Cibisatamab Biosimilar is a novel antibody that has shown promising results in cancer treatment. Its unique structure and dual mechanism of action make it a potent anti- cancer agent. It is currently being evaluated in clinical trials for various types of cancer and has shown promising results in preclinical studies. With further research and development, Cibisatamab Biosimilar has the potential to become a valuable addition to the arsenal of anti- cancer therapies.

Cibisatamab Biosimilar - Anti-CEACAM5andCD3E;CD3E mAb - Research Grade binds to CD3E Recombinant Protein in ELISA assay

Cibisatamab Biosimilar - Anti-CEACAM5andCD3E;CD3E mAb - Research Grade binds to CD3E Recombinant Protein in ELISA assay

Immobilized CD3E Recombinant Protein (cat. No.PX-P4075) at 0.5µg/mL (100µL/well) can bind Cibisatamab Biosimilar - Anti-CEACAM5andCD3E;CD3E mAb - Research Grade (cat. No.PX-TA1824) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 5.855M.

Cibisatamab Biosimilar - Anti-CEACAM5andCD3E;CD3E mAb - Research Grade binds to CD66e Recombinant Protein in ELISA assay

Cibisatamab Biosimilar - Anti-CEACAM5andCD3E;CD3E mAb - Research Grade binds to CD66e Recombinant Protein in ELISA assay

Immobilized CD66e Recombinant Protein (cat. No.PX-P4089) at 0.5µg/mL (100µL/well) can bind Cibisatamab Biosimilar - Anti-CEACAM5andCD3E;CD3E mAb - Research Grade (cat. No.PX-TA1824) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 3.461M.

Cibisatamab Biosimilar - Anti-CEACAM5&CD3E;CD3E mAb - Research Grade

There are no reviews yet.

Be the first to review “Cibisatamab Biosimilar – Anti-CEACAM5&CD3E;CD3E mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products