Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

CD3E Recombinant Protein

  • PX-P4075-100
  • Validated ELISA
Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P07766
Molecular weight:
18kDa

Original price was: $595.00.Current price is: $500.00.

100ug 16% OFF + 500 loyalty points
Met1~Asp126 His
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Mosunetuzumab Biosimilar - Anti-CD3E, MS4A1, CD20 mAb binds to CD3E Recombinant Protein in indirect ELISA Assay
Cibisatamab Biosimilar - Anti-CEACAM5andCD3E;CD3E mAb - Research Grade binds to CD3E Recombinant Protein in ELISA assay
Vibecotamab Biosimilar - Anti-CD123;IL-3Rα and CD3E mAb - Research Grade binds to CD3E Recombinant Protein in ELISA assay
CD3E Recombinant Protein

CD3E Recombinant Protein

Product name PX-P4075-100
Uniprot ID P07766
Uniprot link http://www.uniprot.org/uniprot/P07766
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD
Molecular weight 18kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Store at - 20℃ to -80℃.It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Asp126
Aliases /Synonyms T3E
Reference PX-P4075
Note For research use only.
Molecular Constructor
Met1~Asp126 His
Product name PX-P4075-1MG
Uniprot ID P07766
Uniprot link http://www.uniprot.org/uniprot/P07766
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD
Molecular weight 18kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Store at - 20℃ to -80℃.It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Asp126
Aliases /Synonyms T3E
Reference PX-P4075
Note For research use only.
Molecular Constructor
Met1~Asp126 His
Product name PX-P4075-50
Uniprot ID P07766
Uniprot link http://www.uniprot.org/uniprot/P07766
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD
Molecular weight 18kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Store at - 20℃ to -80℃.It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Asp126
Aliases /Synonyms T3E
Reference PX-P4075
Note For research use only.
Molecular Constructor
Met1~Asp126 His

Mosunetuzumab Biosimilar - Anti-CD3E, MS4A1, CD20 mAb binds to CD3E Recombinant Protein in indirect ELISA Assay

Mosunetuzumab Biosimilar - Anti-CD3E, MS4A1, CD20 mAb binds to CD3E Recombinant Protein in indirect ELISA Assay

Immobilized CD3E Recombinant Protein (cat. No.PX-P4075) at 0.5µg/mL (100µL/well) can bind to Mosunetuzumab Biosimilar - Anti-CD3E, MS4A1, CD20 mAb (cat. No.PX-TA1482) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Cibisatamab Biosimilar - Anti-CEACAM5andCD3E;CD3E mAb - Research Grade binds to CD3E Recombinant Protein in ELISA assay

Cibisatamab Biosimilar - Anti-CEACAM5andCD3E;CD3E mAb - Research Grade binds to CD3E Recombinant Protein in ELISA assay

Immobilized CD3E Recombinant Protein (cat. No.PX-P4075) at 0.5µg/mL (100µL/well) can bind Cibisatamab Biosimilar - Anti-CEACAM5andCD3E;CD3E mAb - Research Grade (cat. No.PX-TA1824) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 5.855M.

Vibecotamab Biosimilar - Anti-CD123;IL-3Rα and CD3E mAb - Research Grade binds to CD3E Recombinant Protein in ELISA assay

Vibecotamab Biosimilar - Anti-CD123;IL-3Rα and CD3E mAb - Research Grade binds to CD3E Recombinant Protein in ELISA assay

Immobilized CD3E Recombinant Protein (cat. No.PX-P4075) at 0.5µg/mL (100µL/well) can bind Vibecotamab Biosimilar - Anti-CD123;IL-3Rα and CD3E mAb - Research Grade (cat. No.PX-TA1564) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 2.045M.

CD3E Recombinant Protein

There are no reviews yet.

Be the first to review “CD3E Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products