Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Vibecotamab Biosimilar – Anti-CD3 epsilon, IL3RA mAb – Research Grade

  • PX-TA1564-100UG
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1-kappa / scFv-h-CH2-CH3

Original price was: $290.00.Current price is: $238.00.

100ug 18% OFF + 238 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Vibecotamab Biosimilar - Anti-CD3 epsilon, IL3RA mAb - Research Grade

Product name Vibecotamab Biosimilar - Anti-CD3 epsilon, IL3RA mAb - Research Grade
Uniprot ID P26951 & P07766
Source CAS 2138442-13-2
Species Chimeric
Raw Antigen Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Vibecotamab ,XmAb14045,CD3 epsilon, IL3RA,anti-CD3 epsilon, IL3RA
Reference PX-TA1564
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa / scFv-h-CH2-CH3
Clonality Monoclonal Antibody
Product name Vibecotamab Biosimilar - Anti-CD3 epsilon, IL3RA mAb - Research Grade
Uniprot ID P26951 & P07766
Source CAS 2138442-13-2
Species Chimeric
Raw Antigen Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Vibecotamab ,XmAb14045,CD3 epsilon, IL3RA,anti-CD3 epsilon, IL3RA
Reference PX-TA1564
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa / scFv-h-CH2-CH3
Clonality Monoclonal Antibody
Product name PX-TA1564-50
Uniprot ID P26951 & P07766
Source CAS 2138442-13-2
Species Chimeric
Raw Antigen Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Vibecotamab ,XmAb14045,CD3 epsilon, IL3RA,anti-CD3 epsilon, IL3RA
Reference PX-TA1564
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa / scFv-h-CH2-CH3
Clonality Monoclonal Antibody

Vibecotamab Biosimilar: A Promising Antibody Targeting IL3RA for Therapeutic Applications

The Structure of Vibecotamab Biosimilar

Vibecotamab Biosimilar, also known as Anti-CD3 epsilon, IL3RA mAb – Research Grade, is a monoclonal antibody (mAb) that specifically targets the interleukin-3 receptor alpha (IL3RA). It is a biosimilar version of the original antibody, Vibecotamab, which has been developed for research purposes. The biosimilar version has been designed to have a similar structure and function as the original antibody, making it a cost-effective alternative for research studies.

Vibecotamab Biosimilar is composed of two heavy chains and two light chains, held together by disulfide bonds. The heavy chains consist of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains consist of two constant domains (CL and CL2) and one variable domain (VL). The variable domains are responsible for binding to the IL3RA target, while the constant domains provide stability and effector functions.

The Activity of Vibecotamab Biosimilar

The primary activity of Vibecotamab Biosimilar is to bind to the IL3RA receptor with high specificity and affinity. IL3RA is a cell surface receptor that is expressed on various immune cells, including T cells, B cells, and natural killer cells. By binding to IL3RA, Vibecotamab Biosimilar can modulate the function of these immune cells and regulate immune responses.

One of the key mechanisms of action of Vibecotamab Biosimilar is through the activation of T cells. Upon binding to IL3RA on T cells, the antibody triggers the recruitment of co-receptors and signaling molecules, leading to the activation and proliferation of T cells. This can enhance the immune response against cancer cells and infectious agents.

Additionally, Vibecotamab Biosimilar can also induce antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC) against IL3RA-expressing cells. This means that the antibody can recruit other immune cells, such as natural killer cells and macrophages, to target and destroy IL3RA-positive cells.

The Application of Vibecotamab Biosimilar

Vibecotamab Biosimilar has shown promising results in preclinical studies and is currently being evaluated in clinical trials for the treatment of various diseases. Its primary application is in the field of oncology, where it is being studied as a potential therapy for hematologic malignancies, such as acute myeloid leukemia and multiple myeloma.

In addition to its anti-

cancer properties, Vibecotamab Biosimilar also has potential therapeutic applications in autoimmune diseases and inflammatory disorders. By targeting IL3RA, the antibody can regulate the activity of immune cells and reduce inflammation, making it a potential treatment option for diseases such as rheumatoid arthritis and multiple sclerosis.

Furthermore, Vibecotamab Biosimilar can also be used in research studies to investigate the role of IL3RA in various diseases and to develop new therapies targeting this receptor. Its biosimilar nature makes it a cost-effective and reliable tool for researchers to explore the potential of IL3RA as a therapeutic target.

In Conclusion

Vibecotamab Biosimilar is a monoclonal antibody that specifically targets IL3RA, a cell surface receptor involved in immune responses. Its structure, activity, and application make it a promising therapy for various diseases, particularly in the field of oncology. As a biosimilar version of the original antibody, it provides a cost-effective and reliable option for research studies and has the potential to contribute to the development of new therapies targeting IL3RA.

Vibecotamab Biosimilar - Anti-CD123;IL-3Rα and CD3E mAb - Research Grade binds to CD3E Recombinant Protein in ELISA assay

Vibecotamab Biosimilar - Anti-CD123;IL-3Rα and CD3E mAb - Research Grade binds to CD3E Recombinant Protein in ELISA assay

Immobilized CD3E Recombinant Protein (cat. No.PX-P4075) at 0.5µg/mL (100µL/well) can bind Vibecotamab Biosimilar - Anti-CD123;IL-3Rα and CD3E mAb - Research Grade (cat. No.PX-TA1564) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 2.045M.

Vibecotamab  Biosimilar - Anti-CD3 epsilon,  IL3RA mAb - Research Grade

There are no reviews yet.

Be the first to review “Vibecotamab Biosimilar – Anti-CD3 epsilon, IL3RA mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products