Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Acimtamig Biosimilar – Anti-CD30L receptor mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG VH-V-kappa-VH'-V-lambda homodimer

Original price was: $205.00.Current price is: $167.00.

50ug 19% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Acimtamig Biosimilar - Anti-CD30L receptor mAb - Research Grade

Product name Acimtamig Biosimilar - Anti-CD30L receptor mAb - Research Grade
Uniprot ID P28908 & P08637
Source CAS: 2738880-26-5
Species Human
Raw Antigen Sequence MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-CD30L receptor, Ki-1 antigen, CD30, TNFRSF8, D1S166E, Tumor necrosis factor receptor superfamily member 8, Lymphocyte activation antigen CD30, CD16a, CD16A, FCGR3A, Fc-gamma RIII-alpha, FcRIIIa, IgG Fc receptor III-2, Low affinity immunoglobulin gamma Fc region receptor III-A, IGFR3, CD16a antigen, Fc-gamma RIII, FCGR3, Fc-gamma RIIIa, FCG3, FcRIII, FcR-10
Reference PX-TA1981
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG VH-V-kappa-VH'-V-lambda homodimer
Clonality Monoclonal Antibody
Product name Acimtamig Biosimilar - Anti-CD30L receptor mAb - Research Grade
Uniprot ID P28908 & P08637
Source CAS: 2738880-26-5
Species Human
Raw Antigen Sequence MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-CD30L receptor, Ki-1 antigen, CD30, TNFRSF8, D1S166E, Tumor necrosis factor receptor superfamily member 8, Lymphocyte activation antigen CD30, CD16a, CD16A, FCGR3A, Fc-gamma RIII-alpha, FcRIIIa, IgG Fc receptor III-2, Low affinity immunoglobulin gamma Fc region receptor III-A, IGFR3, CD16a antigen, Fc-gamma RIII, FCGR3, Fc-gamma RIIIa, FCG3, FcRIII, FcR-10
Reference PX-TA1981
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG VH-V-kappa-VH'-V-lambda homodimer
Clonality Monoclonal Antibody
Product name PX-TA1981-50
Uniprot ID P28908 & P08637
Source CAS: 2738880-26-5
Species Human
Raw Antigen Sequence MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-CD30L receptor, Ki-1 antigen, CD30, TNFRSF8, D1S166E, Tumor necrosis factor receptor superfamily member 8, Lymphocyte activation antigen CD30, CD16a, CD16A, FCGR3A, Fc-gamma RIII-alpha, FcRIIIa, IgG Fc receptor III-2, Low affinity immunoglobulin gamma Fc region receptor III-A, IGFR3, CD16a antigen, Fc-gamma RIII, FCGR3, Fc-gamma RIIIa, FCG3, FcRIII, FcR-10
Reference PX-TA1981
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG VH-V-kappa-VH'-V-lambda homodimer
Clonality Monoclonal Antibody

Introduction

Acimtamig Biosimilar is a novel therapeutic antibody that targets the CD30L receptor, a protein that plays a crucial role in immune regulation and is overexpressed in various diseases. This biosimilar is a research grade antibody that has shown promising results in preclinical studies and has the potential to revolutionize the treatment of various diseases. In this article, we will delve into the structure, activity, and potential applications of Acimtamig Biosimilar.

Structure of Acimtamig Biosimilar

Acimtamig Biosimilar is a monoclonal antibody (mAb) that is derived from a hybridoma cell line. It is a recombinant antibody that is produced using a combination of genetic engineering and cell culture techniques. The antibody consists of two heavy chains and two light chains, which are connected by disulfide bonds. The variable region of the antibody is responsible for binding to the CD30L receptor, while the constant region determines the antibody’s effector functions.

Activity of Acimtamig Biosimilar

The main activity of Acimtamig Biosimilar is to bind to the CD30L receptor and block its activity. The CD30L receptor is a member of the tumor necrosis factor (TNF) superfamily and is expressed on the surface of various cells, including immune cells and tumor cells. It plays a critical role in immune regulation and is involved in the development and progression of various diseases. By binding to the CD30L receptor, Acimtamig Biosimilar inhibits its signaling and prevents the harmful effects of CD30L overexpression.

Potential Applications of Acimtamig Biosimilar

Acimtamig Biosimilar has shown promising results in preclinical studies and has the potential to be used in various disease conditions. Some of the potential applications of this biosimilar include:

1. Treatment of autoimmune diseases The CD30L receptor is involved in the development of autoimmune diseases, such as rheumatoid arthritis and multiple sclerosis. Acimtamig Biosimilar has the potential to be used as a therapeutic agent for these diseases by inhibiting the activity of the CD30L receptor and reducing the harmful effects of autoimmune responses.

2.

Cancer therapy

CD30L is overexpressed in various types of cancer, including Hodgkin’s lymphoma and certain types of non-Hodgkin’s lymphoma. Acimtamig Biosimilar has shown promising results in preclinical studies as a potential treatment for these cancers by targeting the CD30L receptor and inhibiting its activity. This biosimilar can be used alone or in combination with other cancer therapies to enhance their efficacy.

3. Prevention of transplant rejection Acimtamig Biosimilar has the potential to be used in organ transplant patients to prevent transplant rejection. The CD30L receptor is involved in the rejection of transplanted organs, and by blocking its activity, Acimtamig Biosimilar can help improve the success rate of organ transplants.

4. Treatment of inflammatory diseases The CD30L receptor is also involved in the development of inflammatory diseases, such as asthma and inflammatory bowel disease. Acimtamig Biosimilar has the potential to be used as a therapeutic agent for these diseases by inhibiting the activity of the CD30L receptor and reducing inflammation.

Conclusion

In conclusion, Acimtamig Biosimilar is a novel therapeutic antibody that targets the CD30L receptor and has shown promising results in preclinical studies. Its unique structure and mechanism of action make it a potential treatment option for various diseases, including autoimmune diseases, cancer, transplant rejection, and inflammatory diseases. Further clinical studies are needed to validate its efficacy and safety for use in patients.

SDS-PAGE for Research Grade Acimtamig

SDS-PAGE for Research Grade Acimtamig

Research Grade Acimtamig, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Acimtamig Biosimilar - Anti-CD30L receptor mAb - Research Grade

There are no reviews yet.

Be the first to review “Acimtamig Biosimilar – Anti-CD30L receptor mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products