Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Sulesomab Biosimilar – Anti-NCA-90 mAb – Research Grade

  • PX-TA1099-50
  • Validated ELISA FC WB
Clonality:
Monoclonal Antibody
Isotype:
Fab'-G1-nd

Original price was: $220.00.Current price is: $167.00.

50ug 24% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Sulesomab Biosimilar - Anti-NCA-90 mAb - Research Grade

Product name Sulesomab Biosimilar - Anti-NCA-90 mAb - Research Grade
Uniprot ID P40199
Source CAS 167747-19-5
Species Mus musculus
Raw Antigen Sequence MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSGSAPVLSAVATVGITIGVLARVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Sulesomab,IMMU-MN3,Technetium (99mTc) sulesomab,LeukoScan,NCA-90,anti-NCA-90
Reference PX-TA1099
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab'-G1-nd
Clonality Monoclonal Antibody
Product name Sulesomab Biosimilar - Anti-NCA-90 mAb - Research Grade
Uniprot ID P40199
Source CAS 167747-19-5
Species Mus musculus
Raw Antigen Sequence MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSGSAPVLSAVATVGITIGVLARVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Sulesomab,IMMU-MN3,Technetium (99mTc) sulesomab,LeukoScan,NCA-90,anti-NCA-90
Reference PX-TA1099
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab'-G1-nd
Clonality Monoclonal Antibody
Product name PX-TA1099-50
Uniprot ID P40199
Source CAS 167747-19-5
Species Mus musculus
Raw Antigen Sequence MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSGSAPVLSAVATVGITIGVLARVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Sulesomab,IMMU-MN3,Technetium (99mTc) sulesomab,LeukoScan,NCA-90,anti-NCA-90
Reference PX-TA1099
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab'-G1-nd
Clonality Monoclonal Antibody

Introduction to Sulesomab Biosimilar – Anti-NCA-90 mAb – Research Grade

Sulesomab Biosimilar is a monoclonal antibody (mAb) that targets the neutrophil-specific antigen NCA-90. This biosimilar is a research grade product that has been developed to mimic the structure and activity of the original Sulesomab antibody, which is used as a diagnostic tool in the detection of infections and inflammatory processes. In this article, we will delve into the structure, activity, and potential applications of Sulesomab Biosimilar – Anti-NCA-90 mAb – Research Grade.

Structure of Sulesomab Biosimilar – Anti-NCA-90 mAb – Research Grade

Sulesomab Biosimilar is a chimeric monoclonal antibody, meaning it is composed of both human and mouse components. It is a recombinant antibody, produced by cloning the genes that encode for the variable regions of the mouse antibody into a human cell line. This process allows for the production of a humanized antibody that has a lower risk of triggering an immune response in patients.

The antibody has a molecular weight of approximately 150 kDa and is composed of two heavy chains and two light chains. The heavy chains are linked to each other by disulfide bonds and to the light chains by non-covalent interactions. The variable regions of the antibody are responsible for binding to the NCA-90 antigen, while the constant regions provide stability and effector functions.

Activity of Sulesomab Biosimilar – Anti-NCA-90 mAb – Research Grade

Sulesomab Biosimilar works by binding to the NCA-90 antigen, which is expressed on the surface of neutrophils. This binding leads to the activation of the complement system, a group of proteins that play a role in the immune response. The activation of the complement system results in the formation of a membrane attack complex, leading to the lysis of the target cell.

In addition to its role in complement activation, Sulesomab Biosimilar also has anti-inflammatory properties. It has been shown to inhibit the migration of neutrophils, which play a key role in the inflammatory response. This activity may be beneficial in conditions where excessive inflammation is a contributing factor, such as in autoimmune diseases.

Title: Applications of Sulesomab Biosimilar – Anti-NCA-90 mAb – Research Grade Sulesomab Biosimilar – Anti-NCA-90 mAb – Research Grade has potential applications in both research and clinical settings. In research, this biosimilar can be used as a tool to study the role of NCA-90 in various diseases, as well as the complement system and its role in the immune response.

In a clinical setting, Sulesomab Biosimilar can be used as a diagnostic tool for the detection of infections and inflammatory processes. It has been approved for use in the diagnosis of osteomyelitis, a bone infection, and septic arthritis, an infection of the joints. Its ability to target and activate the complement system makes it a valuable tool in the detection of these conditions.

Additionally, Sulesomab Biosimilar may have potential therapeutic applications in conditions where NCA-90 is overexpressed, such as certain types of cancer. By targeting and activating the complement system, this antibody may help in the destruction of cancer cells.

In conclusion, Sulesomab Biosimilar – Anti-NCA-90 mAb – Research Grade is a chimeric monoclonal antibody with a molecular weight of 150 kDa. It binds to the NCA-90 antigen and activates the complement system, leading to the lysis of target cells. This biosimilar has potential applications in research and clinical settings, making it a valuable tool in the study and treatment of various diseases.

Flow Cytometry results for Sulesomab Biosimilar - Anti-CD66c;CEACAM6 mAb - Research Grade

Flow Cytometry results for Sulesomab Biosimilar - Anti-CD66c;CEACAM6 mAb - Research Grade

Target Cells were stained with an irrelevant antibody or Sulesomab Biosimilar - Anti-CD66c;CEACAM6 mAb - Research Grade at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

SDS-PAGE for Sulesomab Biosimilar - Anti-CD66c;CEACAM6 mAb - Research Grade

SDS-PAGE for Sulesomab Biosimilar - Anti-CD66c;CEACAM6 mAb - Research Grade

Sulesomab Biosimilar - Anti-CD66c;CEACAM6 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Sulesomab Biosimilar - Anti-NCA-90 mAb - Research Grade

There are no reviews yet.

Be the first to review “Sulesomab Biosimilar – Anti-NCA-90 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products