Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Porustobart Biosimilar – Anti-CD152 mAb – Research Grade

  • PX-TA2083-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Isotype:
Ig gamma1 VH-h-CH2-CH3 dimer

Original price was: $207.00.Current price is: $167.00.

50ug 19% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Porustobart Biosimilar - Anti-CD152 mAb - Research Grade

Product name Porustobart Biosimilar - Anti-CD152 mAb - Research Grade
Uniprot ID P16410
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-CD152, Cytotoxic T-lymphocyte protein 4, CTLA-4, CTLA4, Cytotoxic T-lymphocyte-associated antigen 4
Reference PX-TA2083
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Ig gamma1 VH-h-CH2-CH3 dimer
Clonality Monoclonal Antibody
Product name Porustobart Biosimilar - Anti-CD152 mAb - Research Grade
Uniprot ID P16410
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-CD152, Cytotoxic T-lymphocyte protein 4, CTLA-4, CTLA4, Cytotoxic T-lymphocyte-associated antigen 4
Reference PX-TA2083
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Ig gamma1 VH-h-CH2-CH3 dimer
Clonality Monoclonal Antibody
Product name PX-TA2083-50
Uniprot ID P16410
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-CD152, Cytotoxic T-lymphocyte protein 4, CTLA-4, CTLA4, Cytotoxic T-lymphocyte-associated antigen 4
Reference PX-TA2083
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Ig gamma1 VH-h-CH2-CH3 dimer
Clonality Monoclonal Antibody

Porustobart Biosimilar – Anti-CD152 mAb – Research Grade is a novel therapeutic antibody that has been developed as a biosimilar to the anti-CD152 monoclonal antibody (mAb) for the treatment of various diseases. In this article, we will explore the structure, activity, and potential applications of this biosimilar in the field of medicine.

Structure of Porustobart Biosimilar

Porustobart Biosimilar is a recombinant humanized IgG1 monoclonal antibody that is designed to target the CD152 protein, also known as cytotoxic T-lymphocyte-associated protein 4 (CTLA-4). The antibody is composed of two heavy chains and two light chains, each containing a variable region and a constant region. The variable regions are responsible for binding to the CD152 protein, while the constant regions determine the effector functions of the antibody.

The structure of Porustobart Biosimilar is highly similar to that of the original anti-CD152 mAb, making it a suitable biosimilar for therapeutic use. The antibody has been engineered to have a longer half-life and improved stability, making it a more effective treatment option.

Activity of Porustobart Biosimilar

Porustobart Biosimilar works by binding to the CD152 protein on the surface of T-cells. This protein is a negative regulator of T-cell activation, and its binding by the antibody prevents the activation of T-cells, thereby suppressing the immune response.

By inhibiting the activity of the CD152 protein, Porustobart Biosimilar can be used to treat various diseases that are caused by an overactive immune response. These include autoimmune diseases, such as rheumatoid arthritis and multiple sclerosis, as well as inflammatory conditions, such as psoriasis and Crohn’s disease.

Furthermore, the antibody has also shown promising results in the treatment of certain types of cancer. By suppressing the immune response, Porustobart Biosimilar can prevent cancer cells from evading detection and destruction by the immune system, thereby enhancing the effectiveness of cancer treatments.

Applications of Porustobart Biosimilar

Porustobart Biosimilar has the potential to be used in a wide range of therapeutic applications. As mentioned earlier, it can be used to treat various autoimmune diseases and inflammatory conditions. Additionally, the antibody can also be used in combination with other cancer treatments to improve their efficacy.

Moreover, Porustobart Biosimilar can also be used in research studies to better understand the role of the CD152 protein in various diseases. By studying the effects of the antibody on different immune responses, researchers can gain valuable insights into the mechanisms of immune regulation and develop new treatment strategies.

Conclusion

Porustobart Biosimilar – Anti-CD152 mAb – Research Grade is a promising therapeutic antibody that has the potential to revolutionize the treatment of various diseases. Its similar structure and activity to the original anti-CD152 mAb make it a suitable biosimilar for therapeutic use, while its improved stability and longer half-life make it a more effective treatment option. With its wide range of potential applications, Porustobart Biosimilar has the potential to greatly benefit patients and advance scientific research in the field of immunology.

Keywords: antibody, therapeutic target, Porustobart Biosimilar, Anti-CD152 mAb, research grade, structure, activity, applications

SDS-PAGE for Porustobart Biosimilar - Anti-CD152 mAb - Research Grade

SDS-PAGE for Porustobart Biosimilar - Anti-CD152 mAb - Research Grade

Porustobart Biosimilar - Anti-CD152 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Porustobart Biosimilar - Anti-CD152 mAb - Research Grade binds to Mouse CD152 recombinant protein in WB Assay

Porustobart Biosimilar - Anti-CD152 mAb - Research Grade binds to Mouse CD152 recombinant protein in WB Assay

Mouse CD152 recombinant protein(cat. No.PX-P6405) can bind Porustobart Biosimilar - Anti-CD152 mAb - Research Grade in Western Blot Assay as detected on gel analysis.

Porustobart Biosimilar - Anti-CD152 mAb - Research Grade

There are no reviews yet.

Be the first to review “Porustobart Biosimilar – Anti-CD152 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products