Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

cT84.66 Biosimilar – Anti-CEACAM5, CD66e mAb – Research Grade

  • PX-TA1103-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody

Original price was: $397.00.Current price is: $308.00.

50ug 22% OFF + 308 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

cT84.66 Biosimilar - Anti-CEACAM5, CD66e mAb - Research Grade

Product name cT84.66 Biosimilar - Anti-CEACAM5, CD66e mAb - Research Grade
Uniprot ID P06731
Species Chimeric
Raw Antigen Sequence MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms cT84.66,90Y-cT84.66,CEACAM5, CD66e,anti-CEACAM5, CD66e
Reference PX-TA1103
Note For research use only. Not suitable for clinical or therapeutic use.
Clonality Monoclonal Antibody
Product name cT84.66 Biosimilar - Anti-CEACAM5, CD66e mAb - Research Grade
Uniprot ID P06731
Species Chimeric
Raw Antigen Sequence MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms cT84.66,90Y-cT84.66,CEACAM5, CD66e,anti-CEACAM5, CD66e
Reference PX-TA1103
Note For research use only. Not suitable for clinical or therapeutic use.
Clonality Monoclonal Antibody
Product name PX-TA1103-50
Uniprot ID P06731
Species Chimeric
Raw Antigen Sequence MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms cT84.66,90Y-cT84.66,CEACAM5, CD66e,anti-CEACAM5, CD66e
Reference PX-TA1103
Note For research use only. Not suitable for clinical or therapeutic use.
Clonality Monoclonal Antibody

Title: Understanding cT84.66 Biosimilar – Anti-CEACAM5, CD66e mAb: A Promising Antibody for Targeting

Cancer Introduction:

cT84.66 Biosimilar – Anti-CEACAM5, CD66e mAb is a monoclonal antibody (mAb) that has gained significant attention in the field of cancer research. This biosimilar is designed to target CEACAM5, also known as CD66e, a protein that is overexpressed in various types of cancer. In this article, we will explore the structure, activity, and potential applications of cT84.66 Biosimilar, highlighting its role as a promising therapeutic antibody for cancer treatment.

Structure of cT84.66 Biosimilar:

cT84.66 Biosimilar is a recombinant humanized IgG1 antibody, meaning it is derived from human antibodies and modified to reduce immunogenicity. It is composed of two heavy chains and two light chains, with a molecular weight of approximately 150 kDa. The antibody has a high affinity for CEACAM5, with a dissociation constant (Kd) in the nanomolar range.

Activity of cT84.66 Biosimilar:

The primary function of cT84.66 Biosimilar is to specifically bind to CEACAM5 on the surface of cancer cells. CEACAM5 is a glycoprotein that is overexpressed in various types of cancer, including colorectal, lung, breast, and pancreatic cancer. This overexpression is associated with increased tumor growth, invasion, and metastasis. By targeting CEACAM5, cT84.66 Biosimilar inhibits these processes and promotes cancer cell death.

In addition to its direct anti-tumor activity, cT84.66 Biosimilar also has immune-modulating effects. It can activate immune cells, such as natural killer (NK) cells and macrophages, to recognize and attack cancer cells. This dual mechanism of action makes cT84.66 Biosimilar a potent anti- cancer agent.

Applications of cT84.66 Biosimilar:

1.

Cancer diagnosis:

cT84.66 Biosimilar can be used as a diagnostic tool for cancer. CEACAM5 is not only overexpressed on cancer cells but also shed into the blood. By detecting the presence of CEACAM5 using cT84.66 Biosimilar, cancer can be diagnosed at an early stage, allowing for timely treatment.

2.

Cancer treatment:

The primary application of cT84.66 Biosimilar is in cancer treatment. Its ability to specifically target and kill cancer cells, as well as activate the immune system, makes it a promising therapeutic option for various types of cancer. Clinical trials have shown promising results in patients with colorectal, lung, and pancreatic cancer.

3. Research tool: cT84.66 Biosimilar is also used as a research tool to study the role of CEACAM5 in cancer. By using this biosimilar, researchers can better understand the mechanisms of CEACAM5 in tumor growth and metastasis, as well as evaluate the efficacy of new cancer therapies targeting this protein.

Conclusion:

cT84.66 Biosimilar – Anti-CEACAM5, CD66e mAb is a promising antibody with a specific affinity for CEACAM5, a protein overexpressed in various types of cancer. Its dual mechanism of action, targeting cancer cells and activating the immune system, makes it a potent anti- cancer agent. With its potential applications in cancer diagnosis, treatment, and research, cT84.66 Biosimilar holds great promise for improving the outcomes of cancer patients.

SDS-PAGE for cT84.66 Biosimilar - Anti-CD66e;CEA mAb - Research Grade

SDS-PAGE for cT84.66 Biosimilar - Anti-CD66e;CEA mAb - Research Grade

cT84.66 Biosimilar - Anti-CD66e;CEA mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

cT84.66 Biosimilar - Anti-CD66e;CEA mAb - Research Grade in ELISA Assay

cT84.66 Biosimilar - Anti-CD66e;CEA mAb - Research Grade in ELISA Assay

cT84.66 Biosimilar - Anti-CD66e;CEA mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

cT84.66 Biosimilar - Anti-CEACAM5, CD66e mAb - Research Grade

There are no reviews yet.

Be the first to review “cT84.66 Biosimilar – Anti-CEACAM5, CD66e mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products