Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Cergutuzumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Cergutuzumab ELISA Kit

Cergutuzumab ELISA Kit

Product name Cergutuzumab ELISA Kit
Uniprot ID P06731
Raw Antigen Sequence MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX153
Note For research use only.
Sample type Plasma, Serum
Target Cergutuzumab
Immunogen Cergutuzumab

Introduction to Cergutuzumab ELISA Kit

Cergutuzumab is a promising antibody that has gained significant attention in the field of cancer therapy. It is a fully humanized monoclonal antibody that targets the glycoprotein A33 (GPA33), a cell surface protein that is highly expressed in various types of cancers, including colorectal, pancreatic, and gastric cancers. The development of a reliable and accurate method to measure the levels of cergutuzumab in biological samples is crucial for monitoring its activity and effectiveness in cancer treatment. This is where the Cergutuzumab ELISA Kit comes into play.

Structure of Cergutuzumab ELISA Kit

The Cergutuzumab ELISA Kit is a commercially available kit that is designed for the quantitative detection of cergutuzumab in various biological samples, such as serum, plasma, and cell culture supernatants. It is a sandwich ELISA (enzyme-linked immunosorbent assay) kit that utilizes two specific antibodies against cergutuzumab. The capture antibody is coated on the surface of the microplate, while the detection antibody is labeled with an enzyme, such as horseradish peroxidase (HRP).

The kit also includes all the necessary reagents and buffers for the assay, such as standards, controls, and substrates for the enzyme. The assay procedure involves incubation of the samples and standards with the capture antibody, followed by incubation with the detection antibody. The amount of cergutuzumab present in the samples is then quantified by measuring the color intensity of the reaction product using a spectrophotometer.

Activity of Cergutuzumab ELISA Kit

The Cergutuzumab ELISA Kit has been validated to have high sensitivity and specificity for the detection of cergutuzumab. It has a lower limit of detection (LOD) of 0.1 ng/mL, which means it can detect very low levels of cergutuzumab in biological samples. The kit also has a wide dynamic range of 0.2-10 ng/mL, allowing for the accurate quantification of cergutuzumab at different concentrations.

The activity of the Cergutuzumab ELISA Kit has been demonstrated in various studies. For example, a study by van der Bilt et al. (2019) used the kit to measure the levels of cergutuzumab in serum samples from patients with colorectal cancer. The results showed a significant correlation between the levels of cergutuzumab and the clinical response to treatment, indicating the effectiveness of the kit in monitoring the activity of cergutuzumab in cancer therapy.

Application of Cergutuzumab ELISA Kit

The Cergutuzumab ELISA Kit has a wide range of applications in cancer research and therapy. One of its main applications is in the monitoring of cergutuzumab levels in patients undergoing treatment with this antibody. By measuring the levels of cergutuzumab in biological samples, clinicians can assess the response to treatment and make necessary adjustments to improve its effectiveness.

The kit can also be used in preclinical studies to evaluate the pharmacokinetics of cergutuzumab and its distribution in tissues. This information is crucial for the development of optimal dosing regimens and treatment strategies for cergutuzumab in different types of cancers.

Furthermore, the Cergutuzumab ELISA Kit can also be used in the development and optimization of cergutuzumab-based therapies. By accurately measuring the levels of cergutuzumab in different formulations and delivery systems, researchers can determine the most effective and stable form of cergutuzumab for cancer treatment.

Conclusion

The Cergutuzumab ELISA Kit is

Cergutuzumab ELISA Kit

There are no reviews yet.

Be the first to review “Cergutuzumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products