Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Labetuzumab Biosimilar – Anti-CEACAM5 mAb – Research Grade

  • PX-TA1048-100UG
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG-nd

Original price was: $295.00.Current price is: $238.00.

100ug 19% OFF + 238 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Labetuzumab Biosimilar - Anti-CEACAM5 mAb - Research Grade

Product name Labetuzumab Biosimilar - Anti-CEACAM5 mAb - Research Grade
Uniprot ID P06731
Source CAS 219649-07-7
Species Humanized
Raw Antigen Sequence MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Labetuzumab,hMN14,CEACAM5,anti-CEACAM5
Reference PX-TA1048
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG-nd
Clonality Monoclonal Antibody
Product name Labetuzumab Biosimilar - Anti-CEACAM5 mAb - Research Grade
Uniprot ID P06731
Source CAS 219649-07-7
Species Humanized
Raw Antigen Sequence MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Labetuzumab,hMN14,CEACAM5,anti-CEACAM5
Reference PX-TA1048
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG-nd
Clonality Monoclonal Antibody
Product name PX-TA1048-50
Uniprot ID P06731
Source CAS 219649-07-7
Species Humanized
Raw Antigen Sequence MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Labetuzumab,hMN14,CEACAM5,anti-CEACAM5
Reference PX-TA1048
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG-nd
Clonality Monoclonal Antibody

Introduction

Labetuzumab biosimilar, also known as anti-CEACAM5 monoclonal antibody (mAb), is a promising therapeutic agent that has been developed as a biosimilar to the original Labetuzumab. This biosimilar is a highly specific and potent antibody that targets the carcinoembryonic antigen-related cell adhesion molecule 5 (CEACAM5), which is a well-known tumor-associated antigen. In this article, we will discuss the structure, activity, and potential applications of Labetuzumab biosimilar in the field of cancer research.

Structure of Labetuzumab Biosimilar

Labetuzumab biosimilar is a recombinant humanized IgG1 monoclonal antibody that has been specifically designed to target CEACAM5. It is composed of two heavy chains and two light chains, each containing a variable and constant region. The variable region of Labetuzumab biosimilar is responsible for its high specificity towards CEACAM5, while the constant region mediates its effector functions. The antibody also contains a hinge region, which allows for flexibility and binding to the target antigen.

Activity of Labetuzumab Biosimilar

Labetuzumab biosimilar exerts its activity by binding to CEACAM5, which is overexpressed on the surface of various cancer cells, including colorectal, pancreatic, and lung cancer cells. The binding of Labetuzumab biosimilar to CEACAM5 leads to the activation of various signaling pathways, including the PI3K/AKT and MAPK pathways, resulting in the inhibition of tumor growth and proliferation. Additionally, Labetuzumab biosimilar also induces antibody-dependent cell-mediated cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC), which further enhances its anti-tumor activity.

Applications of Labetuzumab Biosimilar

Labetuzumab biosimilar has shown promising results in preclinical studies and is currently being evaluated in clinical trials for the treatment of various types of cancer. Its high specificity towards CEACAM5 makes it a potential therapeutic option for cancers that overexpress this antigen. The most common application of Labetuzumab biosimilar is in the treatment of colorectal cancer, where CEACAM5 is highly expressed. It has also shown potential in the treatment of other solid tumors, such as pancreatic and lung cancer.

In addition to its use as a monotherapy, Labetuzumab biosimilar has also been studied in combination with other anti- cancer agents. Studies have shown that combining Labetuzumab biosimilar with chemotherapy or other targeted therapies can enhance its anti-tumor activity and improve treatment outcomes. This makes Labetuzumab biosimilar a promising candidate for combination therapy in the future.

Research Grade Labetuzumab Biosimilar

Apart from its potential as a therapeutic agent, Labetuzumab biosimilar is also available in a research grade form for use in laboratory research. This research grade antibody can be used in various in vitro and in vivo studies to further understand the mechanism of action of Labetuzumab biosimilar and its potential applications in different cancer types. Its high specificity and potency make it a valuable tool for researchers studying CEACAM5 and its role in cancer.

Conclusion

In summary, Labetuzumab biosimilar is a highly specific and potent antibody that targets CEACAM5, a tumor-associated antigen that is overexpressed in various types of cancer. Its unique structure and mechanism of action make it a promising therapeutic agent for the treatment of solid tumors, particularly colorectal cancer. Further research and clinical trials are needed to fully evaluate the potential of Labetuzumab biosimilar in the field of cancer therapy. Additionally, its availability in a research grade form makes it a valuable tool for further research and development in this area.

Labetuzumab Biosimilar - Anti-CEACAM5 mAb binds to CD66e Recombinant Protein in indirect ELISA Assay

Labetuzumab Biosimilar - Anti-CEACAM5 mAb binds to CD66e Recombinant Protein in indirect ELISA Assay

Immobilized CD66e Recombinant Protein (cat. No.PX-P4089) at 0.5µg/mL (100µL/well) can bind to Labetuzumab Biosimilar - Anti-CEACAM5 mAb (cat. No.PX-TA1048) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Labetuzumab Biosimilar - Anti-CEACAM5 mAb - Research Grade

There are no reviews yet.

Be the first to review “Labetuzumab Biosimilar – Anti-CEACAM5 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products