Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Labetuzumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Labetuzumab ELISA Kit

Labetuzumab ELISA Kit

Product name Labetuzumab ELISA Kit
Uniprot ID P06731
Raw Antigen Sequence MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX154
Note For research use only.
Sample type Plasma, Serum
Target Labetuzumab
Immunogen Labetuzumab

The Structure of Labetuzumab ELISA Kit

Labetuzumab ELISA Kit is a highly sensitive and specific enzyme-linked immunosorbent assay (ELISA) designed for the detection and quantification of Labetuzumab, a monoclonal antibody used as a therapeutic agent in cancer treatment. The kit is composed of a solid phase microtiter plate coated with a specific capture antibody, a detection antibody labeled with an enzyme, and all the necessary reagents and buffers.

The capture antibody is a mouse monoclonal antibody that specifically binds to Labetuzumab. The detection antibody is a biotinylated version of the same monoclonal antibody, which is then conjugated to streptavidin-peroxidase. This conjugate binds to the biotinylated detection antibody, forming a sandwich complex with the captured Labetuzumab. The amount of Labetuzumab present in the sample is directly proportional to the color intensity of the complex, which can be measured spectrophotometrically.

The Activity of Labetuzumab ELISA Kit

The Labetuzumab ELISA Kit is a highly sensitive and specific method for the detection and quantification of Labetuzumab in various biological samples such as serum, plasma, and cell culture supernatants. The kit has a detection limit of 0.1 ng/mL and a dynamic range of 0.5-100 ng/mL, making it suitable for the quantification of both high and low levels of Labetuzumab.

The activity of the kit is based on the principle of sandwich ELISA, which allows for the specific detection and quantification of Labetuzumab without interference from other proteins or antibodies present in the sample. The kit also includes a standard curve, which is used to determine the concentration of Labetuzumab in the sample by comparing the absorbance values of the sample to those of the standard.

Application of Labetuzumab ELISA Kit

Labetuzumab is a monoclonal antibody that specifically targets the tumor-associated antigen CA19-9, which is overexpressed in various types of cancer, including colorectal, pancreatic, and gastric cancer. Labetuzumab ELISA Kit is a valuable tool for monitoring the levels of Labetuzumab in patients undergoing treatment with this therapeutic antibody.

One of the main applications of the Labetuzumab ELISA Kit is in the pharmacokinetic and pharmacodynamic studies of Labetuzumab. By measuring the levels of Labetuzumab in patients’ serum or plasma, researchers can determine the drug’s absorption, distribution, metabolism, and excretion. This information is crucial for optimizing the dosage and dosing schedule of Labetuzumab to achieve the desired therapeutic effect.

Another important application of the Labetuzumab ELISA Kit is in the evaluation of the efficacy of Labetuzumab in clinical trials. By measuring the levels of Labetuzumab in patients’ serum or plasma before and after treatment, researchers can assess the drug’s ability to reach its target and its impact on tumor growth. This information is crucial for determining the effectiveness of Labetuzumab as a therapeutic agent and for comparing it to other treatment options.

In addition, the Labetuzumab ELISA Kit can also be used in research studies to investigate the role of Labetuzumab in cancer biology. By quantifying the levels of Labetuzumab in different biological samples, researchers can gain insights into the mechanisms of action of this therapeutic antibody and its potential as a therapeutic target for cancer treatment.

In conclusion, the Labetuzumab ELISA Kit is a highly sensitive and specific method for the detection and quantification of Labetuzumab, a monoclonal antibody used as a therapeutic agent in cancer treatment. Its structure and activity make it a valuable tool for monitoring the levels of Labetuzumab in patients, evaluating its efficacy in clinical trials, and investigating its role in cancer biology.

Labetuzumab ELISA Kit

There are no reviews yet.

Be the first to review “Labetuzumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products