Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Arcitumomab Biosimilar – Anti-CEACAM5, CD66e mAb – Research Grade

  • PX-TA1077-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
Fab'-G1-nd

Original price was: $225.00.Current price is: $167.00.

50ug 26% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Arcitumomab Biosimilar - Anti-CEACAM5, CD66e mAb - Research Grade

Product name Arcitumomab Biosimilar - Anti-CEACAM5, CD66e mAb - Research Grade
Uniprot ID P06731
Source CAS 154361-48-5
Species Mus musculus
Raw Antigen Sequence MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
Molecular weight 50kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Arcitumomab,CEA-Scan,IMMU-4,CEACAM5, CD66e,anti-CEACAM5, CD66e
Reference PX-TA1077
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab'-G1-nd
Clonality Monoclonal Antibody
Product name Arcitumomab Biosimilar - Anti-CEACAM5, CD66e mAb - Research Grade
Uniprot ID P06731
Source CAS 154361-48-5
Species Mus musculus
Raw Antigen Sequence MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
Molecular weight 50kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Arcitumomab,CEA-Scan,IMMU-4,CEACAM5, CD66e,anti-CEACAM5, CD66e
Reference PX-TA1077
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab'-G1-nd
Clonality Monoclonal Antibody
Product name PX-TA1077-50
Uniprot ID P06731
Source CAS 154361-48-5
Species Mus musculus
Raw Antigen Sequence MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
Molecular weight 50kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Arcitumomab,CEA-Scan,IMMU-4,CEACAM5, CD66e,anti-CEACAM5, CD66e
Reference PX-TA1077
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab'-G1-nd
Clonality Monoclonal Antibody

Introduction

Arcitumomab Biosimilar is a monoclonal antibody (mAb) that specifically targets carcinoembryonic antigen-related cell adhesion molecule 5 (CEACAM5), also known as CD66e. It is a research-grade antibody that has shown potential as a therapeutic agent for various cancers. In this article, we will explore the structure, activity, and potential applications of Arcitumomab Biosimilar in detail.

Structure of Arcitumomab Biosimilar

Arcitumomab Biosimilar is a recombinant humanized IgG1 kappa mAb that is produced in CHO cells. It is composed of two heavy chains and two light chains, each containing a variable region and a constant region. The variable region is responsible for binding to the target antigen, while the constant region mediates effector functions such as complement-dependent cytotoxicity and antibody-dependent cellular cytotoxicity.

Activity of Arcitumomab Biosimilar

The primary target of Arcitumomab Biosimilar is CEACAM5, which is overexpressed in various types of cancer, including colorectal, lung, breast, and pancreatic cancer. CEACAM5 is a cell surface glycoprotein that plays a role in cell adhesion and signaling. Arcitumomab Biosimilar binds to CEACAM5 with high affinity and specificity, leading to the inhibition of tumor growth and metastasis.

In addition to its direct antitumor activity, Arcitumomab Biosimilar has been shown to enhance the immune response against cancer cells. It can induce antibody-dependent cellular cytotoxicity, which involves the activation of immune cells such as natural killer cells and macrophages to kill cancer cells. This mechanism of action makes Arcitumomab Biosimilar a promising candidate for combination therapy with other anticancer agents.

Applications of Arcitumomab Biosimilar

The potential applications of Arcitumomab Biosimilar are vast, with ongoing research in various cancer types. In colorectal cancer, Arcitumomab Biosimilar has been studied as a diagnostic tool for detecting the presence of CEACAM5 in tumors. It has also shown promising results in combination with chemotherapy for the treatment of advanced colorectal cancer.

In lung

cancer, Arcitumomab Biosimilar has been investigated as a potential therapeutic agent for both non-small cell lung cancer and small cell lung cancer. In a phase II clinical trial, Arcitumomab Biosimilar showed a significant increase in progression-free survival in patients with advanced non-small cell lung cancer when combined with chemotherapy.

Furthermore, Arcitumomab Biosimilar has shown potential in breast

cancer, with preclinical studies showing its ability to inhibit tumor growth and metastasis. It has also been studied in pancreatic cancer, where it has demonstrated antitumor activity in both in vitro and in vivo models.

Conclusion

Arcitumomab Biosimilar is a promising research-grade antibody that specifically targets CEACAM5, a cell surface glycoprotein that is overexpressed in various types of cancer. Its unique mechanism of action, which includes both direct antitumor activity and immune modulation, makes it a potential therapeutic agent for a wide range of cancers. Ongoing research and clinical trials will continue to explore the full potential of Arcitumomab Biosimilar in the treatment of cancer.

Arcitumomab Biosimilar - Anti-CD66e,CEA mAb - Research Grade binds to CD66e Recombinant Protein in ELISA assay

Arcitumomab Biosimilar - Anti-CD66e,CEA mAb - Research Grade binds to CD66e Recombinant Protein in ELISA assay

Immobilized CD66e Recombinant Protein (cat. No.PX-P4089) at 0.5µg/mL (100µL/well) can bind Arcitumomab Biosimilar - Anti-CD66e,CEA mAb - Research Grade (cat. No.PX-TA1077) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 13.80M.

SDS-PAGE for Arcitumomab Biosimilar - Anti-CD66e;CEA mAb - Research Grade

SDS-PAGE for Arcitumomab Biosimilar - Anti-CD66e;CEA mAb - Research Grade

Arcitumomab Biosimilar - Anti-CD66e;CEA mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Arcitumomab Biosimilar - Anti-CEACAM5, CD66e mAb - Research Grade

There are no reviews yet.

Be the first to review “Arcitumomab Biosimilar – Anti-CEACAM5, CD66e mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products