Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Dusigitumab Biosimilar – Anti-IGF1, IGF2 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG2-nd

Original price was: $230.00.Current price is: $167.00.

50ug 27% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Dusigitumab Biosimilar - Anti-IGF1, IGF2 mAb - Research Grade

Product name Dusigitumab Biosimilar - Anti-IGF1, IGF2 mAb - Research Grade
Uniprot ID P05019 & P01344
Source CAS 1204390-13-5
Species Homo sapiens
Raw Antigen Sequence MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGK
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Dusigitumab,MEDI-573,IGF1, IGF2,anti-IGF1, IGF2
Reference PX-TA1310
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-nd
Clonality Monoclonal Antibody
Product name Dusigitumab Biosimilar - Anti-IGF1, IGF2 mAb - Research Grade
Uniprot ID P05019 & P01344
Source CAS 1204390-13-5
Species Homo sapiens
Raw Antigen Sequence MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGK
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Dusigitumab,MEDI-573,IGF1, IGF2,anti-IGF1, IGF2
Reference PX-TA1310
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-nd
Clonality Monoclonal Antibody
Product name PX-TA1310-50
Uniprot ID P05019 & P01344
Source CAS 1204390-13-5
Species Homo sapiens
Raw Antigen Sequence MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGK
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Dusigitumab,MEDI-573,IGF1, IGF2,anti-IGF1, IGF2
Reference PX-TA1310
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-nd
Clonality Monoclonal Antibody

General information on Anti-IGF1/IGF2[Homo sapiens] (Dusigitumab) Monoclonal Antibody

Dusigitumab has been investigated for the treatment of Cancer, Advanced Solid Malignancies, Unresectable or Metastatic Hepatocellular Carcinoma (HCC), and Hormone-sensitive, HER-2 Negative Metastatic Breast Cancer.

SDS-PAGE for Dusigitumab Biosimilar - Anti-IGF1 and IGF2 mAb - Research Grade

SDS-PAGE for Dusigitumab Biosimilar - Anti-IGF1 and IGF2 mAb - Research Grade

Dusigitumab Biosimilar - Anti-IGF1 and IGF2 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Dusigitumab Biosimilar - Anti-IGF1, IGF2 mAb - Research Grade

There are no reviews yet.

Be the first to review “Dusigitumab Biosimilar – Anti-IGF1, IGF2 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products