Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD303 / CLEC4C recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8WTT0
Molecular weight:
19.46 kDa

$392.00

100ug + 392 loyalty points
Ser67–Ile213 His
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD303 / CLEC4C recombinant protein

Product name Human CD303 / CLEC4C recombinant protein
Uniprot ID Q8WTT0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI
Molecular weight 19.46 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser67-Ile213
Aliases /Synonyms CLEC4C, C-type lectin superfamily member 7, CLECSF11, C-type lectin domain family 4 member C, Dendritic lectin, CD303, DLEC, HECL, Blood dendritic cell antigen 2, BDCA-2, BDCA2, CLECSF7
Reference PX-P6046
Note For research use only
Molecular Constructor
Ser67–Ile213 His

Human CD303 / CLEC4C recombinant protein

There are no reviews yet.

Be the first to review “Human CD303 / CLEC4C recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products