Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Obertamig Biosimilar – Anti-HLAG mAb – Research Grade

  • PX-TA1980-50
  • Validated WB
Clonality:
Monoclonal Antibody
Isotype:
half IG G1-lambda2/scFv-h-CH2-CH3

Original price was: $233.00.Current price is: $167.00.

50ug 28% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Obertamig Biosimilar - Anti-HLAG mAb - Research Grade

Product name Obertamig Biosimilar - Anti-HLAG mAb - Research Grade
Uniprot ID P17693 & P07766
Source CAS: 2750126-32-8
Species Human
Expression system XtenCHO
Raw Antigen Sequence MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-HLAG, HLA-G, sHLA-G, HLA G antigen, MHC class I antigen G, HLA-6.0, HLA class I histocompatibility antigen, alpha chain G, T3E, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, CD3E, T-cell surface glycoprotein CD3 epsilon chain
Reference PX-TA1980
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype half IG G1-lambda2/scFv-h-CH2-CH3
Clonality Monoclonal Antibody
Product name Obertamig Biosimilar - Anti-HLAG mAb - Research Grade
Uniprot ID P17693 & P07766
Source CAS: 2750126-32-8
Species Human
Expression system XtenCHO
Raw Antigen Sequence MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-HLAG, HLA-G, sHLA-G, HLA G antigen, MHC class I antigen G, HLA-6.0, HLA class I histocompatibility antigen, alpha chain G, T3E, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, CD3E, T-cell surface glycoprotein CD3 epsilon chain
Reference PX-TA1980
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype half IG G1-lambda2/scFv-h-CH2-CH3
Clonality Monoclonal Antibody
Product name PX-TA1980-50
Uniprot ID P17693 & P07766
Source CAS: 2750126-32-8
Species Human
Expression system XtenCHO
Raw Antigen Sequence MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-HLAG, HLA-G, sHLA-G, HLA G antigen, MHC class I antigen G, HLA-6.0, HLA class I histocompatibility antigen, alpha chain G, T3E, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, CD3E, T-cell surface glycoprotein CD3 epsilon chain
Reference PX-TA1980
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype half IG G1-lambda2/scFv-h-CH2-CH3
Clonality Monoclonal Antibody

Introduction

Obertamig Biosimilar – Anti-HLAG mAb is a novel biosimilar antibody that has shown promising results in targeting human leukocyte antigen-G (HLA-G), a therapeutic target involved in various diseases. In this article, we will provide a detailed description of the structure, activity, and potential applications of this biosimilar antibody.

Structure of Obertamig Biosimilar – Anti-HLAG mAb

Obertamig Biosimilar – Anti-HLAG mAb is a monoclonal antibody (mAb) that is produced using recombinant DNA technology. It is a biosimilar version of the original anti-HLAG mAb, which has been extensively studied and used as a therapeutic agent. The biosimilar antibody has a similar structure to the original mAb, with minor modifications to ensure its efficacy and safety.

The antibody is composed of two heavy chains and two light chains, held together by disulfide bonds. The variable regions of the heavy and light chains are responsible for binding to the HLA-G protein, while the constant regions determine the antibody’s effector functions. The biosimilar antibody has been engineered to have high affinity and specificity for HLA-G, making it a potent therapeutic agent.

Activity of Obertamig Biosimilar – Anti-HLAG mAb

Obertamig Biosimilar – Anti-HLAG mAb has been shown to have a strong inhibitory effect on the function of HLA-G. HLA-G is a non-classical major histocompatibility complex (MHC) class I molecule that is expressed in various cells, including immune cells and tumor cells. It plays a crucial role in immune tolerance and has been implicated in the development of various diseases, including cancer, autoimmune disorders, and pregnancy complications.

The biosimilar antibody binds to the HLA-G protein, blocking its interaction with immune cells and preventing its immunosuppressive effects. This leads to the activation of the immune system and the elimination of HLA-G expressing cells. Additionally, the antibody can induce antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC), further enhancing its anti-tumor activity.

Applications of Obertamig Biosimilar – Anti-HLAG mAb

Obertamig Biosimilar – Anti-HLAG mAb has the potential to be used in various therapeutic applications. Its ability to target HLA-G makes it a promising candidate for the treatment of cancer. HLA-G expression has been observed in various types of cancer, and its overexpression has been associated with poor prognosis. By targeting HLA-G, the biosimilar antibody can inhibit tumor growth and enhance the efficacy of other cancer treatments.

Furthermore, the antibody can also be used in the treatment of autoimmune disorders, such as rheumatoid arthritis and multiple sclerosis. HLA-G has been implicated in the development of these diseases, and inhibiting its function can help alleviate symptoms and improve patient outcomes.

In addition, Obertamig Biosimilar – Anti-HLAG mAb can also be used in the field of reproductive medicine. HLA-G plays a crucial role in maintaining immune tolerance during pregnancy, and its dysregulation has been associated with pregnancy complications, such as preeclampsia and recurrent miscarriages. The biosimilar antibody can potentially prevent these complications by targeting HLA-G and restoring immune balance.

Conclusion

In summary, Obertamig Biosimilar – Anti-HLAG mAb is a promising biosimilar antibody that targets HLA-G, a therapeutic target involved in various diseases. Its unique structure and potent inhibitory activity make it a potential treatment option for cancer, autoimmune disorders, and pregnancy complications. Further research and clinical trials are needed to fully explore the potential of this biosimilar antibody in improving patient outcomes.

SDS-PAGE for Research Grade Obertamig

SDS-PAGE for Research Grade Obertamig

Research Grade Obertamig, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Research Grade Obertamig in WB Assay

Research Grade Obertamig in WB Assay

Research Grade Obertamig can bind to its target in Western Blot Assay as detected on gel analysis.

Obertamig Biosimilar - Anti-HLAG mAb - Research Grade

There are no reviews yet.

Be the first to review “Obertamig Biosimilar – Anti-HLAG mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products