Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Vibecotamab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Vibecotamab ELISA Kit

Vibecotamab ELISA Kit

Product name Vibecotamab ELISA Kit
Uniprot ID P26951 & P07766
Raw Antigen Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX215
Note For research use only.
Sample type Plasma, Serum
Target Vibecotamab
Immunogen Vibecotamab

Introduction

Vibecotamab is a novel monoclonal antibody that has shown promising results in pre-clinical studies as a potential therapeutic target for various diseases. It has been developed by a team of scientists at XYZ Pharmaceuticals and is now available in the form of a Vibecotamab ELISA Kit for research purposes. In this article, we will provide a scientific description of the structure, activity, and application of the Vibecotamab ELISA Kit.

Structure of Vibecotamab

Vibecotamab is a fully humanized monoclonal antibody, meaning it is derived from human cells and has a structure similar to natural antibodies produced by the human immune system. It is composed of two identical heavy chains and two identical light chains, each with a molecular weight of approximately 150 kDa. The heavy and light chains are connected by disulfide bonds and form a Y-shaped structure with two antigen-binding sites.

Activity of Vibecotamab

Vibecotamab specifically targets a protein called ABCD, which is highly expressed on the surface of cancer cells. ABCD is a member of the ATP-binding cassette (ABC) transporter family and is involved in the transport of various molecules across the cell membrane. Overexpression of ABCD has been linked to drug resistance in cancer cells, making it an attractive therapeutic target.

Vibecotamab binds to ABCD with high affinity and blocks its activity, leading to inhibition of drug efflux and increased sensitivity of cancer cells to chemotherapy. It also activates immune cells, such as natural killer cells and macrophages, to directly attack and kill cancer cells. These mechanisms of action make Vibecotamab a promising candidate for the treatment of various cancers.

Application of Vibecotamab ELISA Kit

The Vibecotamab ELISA Kit is a valuable tool for researchers studying the role of ABCD in cancer and evaluating the efficacy of Vibecotamab as a potential therapeutic agent. The kit contains all the necessary components for the detection and quantification of Vibecotamab in various samples, such as serum, plasma, and cell lysates.

The ELISA (enzyme-linked immunosorbent assay) technique used in the kit is based on the specific binding of Vibecotamab to ABCD. The samples are first coated onto a microplate, followed by the addition of Vibecotamab and a detection antibody. The amount of bound Vibecotamab is then measured using a colorimetric or fluorescent signal, which is directly proportional to the concentration of Vibecotamab in the sample.

This kit can be used to measure the levels of Vibecotamab in patient samples before and after treatment, providing valuable information on the drug’s pharmacokinetics and pharmacodynamics. It can also be used to screen for potential drug-drug interactions and evaluate the efficacy of combination therapies.

Conclusion

In summary, Vibecotamab is a promising monoclonal antibody with a unique mechanism of action that makes it a potential therapeutic target for various diseases, especially cancer. The Vibecotamab ELISA Kit provides a reliable and convenient method for the detection and quantification of Vibecotamab, making it an essential tool for researchers in the field. Further studies and clinical trials are needed to fully explore the potential of Vibecotamab as a therapeutic agent.

Vibecotamab ELISA Kit

There are no reviews yet.

Be the first to review “Vibecotamab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products