Brand: ProteoGenix

Human T-cell surface glycoprotein CD3 epsilon chain (CD3E) recombinant protein

PX-P4014-10
Quality Chart

Host species:: Mammalian cells
Origin species:: Homo sapiens (Human)
Uniprot ID:: P07766
Molecular weight:: 15.09kDa

$250.00

+ 250 loyalty points

Partial Yes

size size

50ug $250.00
100ug $500.00

Clear

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

Human T-cell surface glycoprotein CD3 epsilon chain (CD3E) recombinant protein

Product name	Human T-cell surface glycoprotein CD3 epsilon chain (CD3E) recombinant protein
Uniprot ID	P07766
Uniprot link	http://www.uniprot.org/uniprot/P07766
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Sequence	MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDGSHHHHHH
Molecular weight	15.09kDa
Protein delivered with Tag?	Yes
Purity estimated	60%
Buffer	50 mM Tris-HCl, pH 8.0, 150 mM NaCl
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Partial
Aliases /Synonyms	CD3E, T3E, TCRE, CD3-E Molecule,Epsilon(CD3-TCR Complex), T-cell surface antigen T3/Leu-4 epsilon chain
Reference	PX-P4014
Note	For research use only
Molecular Constructor	Partial Yes

Product name	Human T-cell surface glycoprotein CD3 epsilon chain (CD3E) recombinant protein
Uniprot ID	P07766
Uniprot link	http://www.uniprot.org/uniprot/P07766
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Sequence	MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDGSHHHHHH
Molecular weight	15.09kDa
Protein delivered with Tag?	Yes
Purity estimated	60%
Buffer	50 mM Tris-HCl, pH 8.0, 150 mM NaCl
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Partial
Aliases /Synonyms	CD3E, T3E, TCRE, CD3-E Molecule,Epsilon(CD3-TCR Complex), T-cell surface antigen T3/Leu-4 epsilon chain
Reference	PX-P4014
Note	For research use only
Molecular Constructor	Partial Yes

There are no reviews yet.

Be the first to review “Human T-cell surface glycoprotein CD3 epsilon chain (CD3E) recombinant protein”

Human T-cell surface glycoprotein CD3 epsilon chain (CD3E) recombinant protein

Human T-cell surface glycoprotein CD3 epsilon chain (CD3E) recombinant protein

Related products

Visilizumab Biosimilar – Anti-CD3E mAb – Research Grade

Blinatumomab Biosimilar – Anti-CD19/CD3E Bispecific Antibody (Research Grade)

Yth12.5 Biosimilar – Anti-CD3E mAb – Research Grade

Muromonab-Cd3 Biosimilar – Anti-CD3E mAb – Research Grade

Tecnemab Biosimilar – Anti-CSPG4, HMW-MAA, CD3E, ERBB2, toxin mAb – Research Grade

Otelixizumab Biosimilar – Anti-CD3E mAb – Research Grade

Foralumab Biosimilar – Anti-CD3E mAb – Research Grade

Solitomab Biosimilar – Anti-CD3E, EpCAM mAb – Research Grade

Pasotuxizumab Biosimilar – Anti-CD3E, FOLH1 mAb – Research Grade

Duvortuxizumab Biosimilar – Anti-CD19, CD3E mAb – Research Grade

Flotetuzumab Biosimilar – Anti-CD3E, IL3RA, CD123 mAb – Research Grade

Mosunetuzumab Biosimilar – Anti-CD3E, MS4A1, CD20 mAb – Research Grade

Tepoditamab Biosimilar – Anti-CD3E, CLEC12A mAb – Research Grade

CD4 Protein – T-cell surface glycoprotein CD4(CD4)

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Human T-cell surface glycoprotein CD3 epsilon chain (CD3E) recombinant protein

Specifications Human T-cell surface glycoprotein CD3 epsilon chain (CD3E) recombinant protein

Documents

Reviews

Related products

Visilizumab Biosimilar – Anti-CD3E mAb – Research Grade

Blinatumomab Biosimilar – Anti-CD19/CD3E Bispecific Antibody (Research Grade)

Yth12.5 Biosimilar – Anti-CD3E mAb – Research Grade

Muromonab-Cd3 Biosimilar – Anti-CD3E mAb – Research Grade

Tecnemab Biosimilar – Anti-CSPG4, HMW-MAA, CD3E, ERBB2, toxin mAb – Research Grade

Otelixizumab Biosimilar – Anti-CD3E mAb – Research Grade

Foralumab Biosimilar – Anti-CD3E mAb – Research Grade

Solitomab Biosimilar – Anti-CD3E, EpCAM mAb – Research Grade

Pasotuxizumab Biosimilar – Anti-CD3E, FOLH1 mAb – Research Grade

Duvortuxizumab Biosimilar – Anti-CD19, CD3E mAb – Research Grade

Flotetuzumab Biosimilar – Anti-CD3E, IL3RA, CD123 mAb – Research Grade

Mosunetuzumab Biosimilar – Anti-CD3E, MS4A1, CD20 mAb – Research Grade

Tepoditamab Biosimilar – Anti-CD3E, CLEC12A mAb – Research Grade

CD4 Protein – T-cell surface glycoprotein CD4(CD4)

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Human T-cell surface glycoprotein CD3 epsilon chain (CD3E) recombinant protein