Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Solitomab Antibody Biosimilar

Isotype:
(scFv-kappa-heavy)-(scFv-heavy-kappa)

Original price was: $232.00.Current price is: $167.00.

50ug 28% OFF + 167 loyalty points

Solitomab Biosimilar – Anti-CD3E, EpCAM mAb – Research Grade

Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Solitomab Antibody Biosimilar

Product name Solitomab Biosimilar - Anti-CD3E, EpCAM mAb - Research Grade
Uniprot ID P16422 & P07766
Source CAS 1005198-65-1
Species Mus musculus
Expression system Mammalian
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Solitomab,MT110,CD3E, EpCAM,anti-CD3E, EpCAM
Reference PX-TA1282
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype (scFv-kappa-heavy)-(scFv-heavy-kappa)
Clonality Monoclonal Antibody
Product name Solitomab Biosimilar - Anti-CD3E, EpCAM mAb - Research Grade
Uniprot ID P16422 & P07766
Source CAS 1005198-65-1
Species Mus musculus
Expression system Mammalian
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Solitomab,MT110,CD3E, EpCAM,anti-CD3E, EpCAM
Reference PX-TA1282
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype (scFv-kappa-heavy)-(scFv-heavy-kappa)
Clonality Monoclonal Antibody
Product name PX-TA1282-50
Uniprot ID P16422 & P07766
Source CAS 1005198-65-1
Species Mus musculus
Expression system Mammalian
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Solitomab,MT110,CD3E, EpCAM,anti-CD3E, EpCAM
Reference PX-TA1282
Note For research use only. Not suitable for human use.
Isotype (scFv-kappa-heavy)-(scFv-heavy-kappa)

Solitomab Antibody Biosimilar – Anti-CD3E/EpCAM Bispecific Antibody

Solitomab is a bispecific antibody targeting CD3E and EpCAM, designed to redirect T-cells toward EpCAM-expressing tumor cells. This Solitomab biosimilar antibody is produced for research applications requiring reliable binding activity and high purity.

Our research grade Solitomab antibody enables scientists to investigate T-cell mediated cytotoxicity, tumor immunology, and bispecific antibody mechanisms in preclinical studies.

This antibody is widely used in research involving EpCAM-positive tumor models, immune cell activation assays, and bispecific antibody development.

Key Features

  • Solitomab biosimilar antibody
  • Anti-CD3E / EpCAM bispecific antibody
  • Research grade quality
  • High purity and reproducibility
  • Suitable for immuno-oncology research
  • Competitive Solitomab antibody price

Applications

This Solitomab antibody biosimilar is suitable for multiple research applications including:

  • T-cell engagement assays
  • EpCAM-targeted immunotherapy research
  • Tumor immunology studies
  • Bispecific antibody development
  • Cancer cell targeting studies

For research use only.

Solitomab Antibody Price

For bulk quantities or custom production, request a custom Solitomab antibody quote.

Why Order Solitomab Biosimilar from Proteogenix

Reliable biosimilar antibody production
Competitive Solitomab antibody pricing
Fast international shipping
Quality-controlled research reagents
Trusted supplier for biotech and academic labs

SDS-PAGE for Solitomab Biosimilar - Anti-CD326;EPCAM and CD3E mAb - Research Grade

SDS-PAGE for Solitomab Biosimilar - Anti-CD326;EPCAM and CD3E mAb - Research Grade

Solitomab Biosimilar - Anti-CD326;EPCAM and CD3E mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Solitomab Antibody Biosimilar

  • Enhanced anti-tumor activity by Zinc Finger Repressor-driven epigenetic silencing of immune checkpoints and TGFBR2 in CAR-T cells and TILs, Marion David, Phillip Schiele, Davide Monteferrario, Gaëlle Saviane, Angélique E. Martelli, Coralie F. Dupont, Caroline Jeanneau, Irène Marchetti, Satish K. Tadi, Julia Vahldick, Lynn N. Truong, Yuanyue Zhou, Igor M. Sauer, Wenzel Schöning, Il-Kang Na, Andreas Reik, Marco Frentsch, Maurus de la Rosa, David Fenard, bioRxiv 2024.10.11.613893; doi: https://doi.org/10.1101/2024.10.11.613893

  • Vele — April 6, 2022

    Great product!

Add a review

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products