Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD326 recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P16422
Molecular weight:
30.58 kDa

Original price was: $146.00.Current price is: $131.00.

10ug 10% OFF + 131 loyalty points
Met1–Lys265 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD326 recombinant protein

Product name Human CD326 recombinant protein
Uniprot ID P16422
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
Molecular weight 30.58 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS,pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Lys265
Protein Accession P16422
Aliases /Synonyms Epithelial glycoprotein 314, M4S1, CD326, EGP, M1S2, KSA, hEGP314, Major gastrointestinal tumor-associated protein GA733-2, EGP314, TACSTD1, Adenocarcinoma-associated antigen, TROP1, Epithelial cell adhesion molecule, EPCAM, Ep-CAM, Epithelial glycoprotein, KS 1/4 antigen, Tumor-associated calcium signal transducer 1, Cell surface glycoprotein Trop-1, GA733-2, Epithelial cell surface antigen, MIC18
Reference PX-P5122
Note For research use only
Molecular Constructor
Met1–Lys265 His
Product name Human CD326 recombinant protein
Uniprot ID P16422
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
Molecular weight 30.58 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS,pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Lys265
Protein Accession P16422
Aliases /Synonyms Epithelial glycoprotein 314, M4S1, CD326, EGP, M1S2, KSA, hEGP314, Major gastrointestinal tumor-associated protein GA733-2, EGP314, TACSTD1, Adenocarcinoma-associated antigen, TROP1, Epithelial cell adhesion molecule, EPCAM, Ep-CAM, Epithelial glycoprotein, KS 1/4 antigen, Tumor-associated calcium signal transducer 1, Cell surface glycoprotein Trop-1, GA733-2, Epithelial cell surface antigen, MIC18
Reference PX-P5122
Note For research use only
Molecular Constructor
Met1–Lys265 His
Product name Human CD326 recombinant protein
Uniprot ID P16422
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
Molecular weight 30.58 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS,pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Lys265
Protein Accession P16422
Aliases /Synonyms Epithelial glycoprotein 314, M4S1, CD326, EGP, M1S2, KSA, hEGP314, Major gastrointestinal tumor-associated protein GA733-2, EGP314, TACSTD1, Adenocarcinoma-associated antigen, TROP1, Epithelial cell adhesion molecule, EPCAM, Ep-CAM, Epithelial glycoprotein, KS 1/4 antigen, Tumor-associated calcium signal transducer 1, Cell surface glycoprotein Trop-1, GA733-2, Epithelial cell surface antigen, MIC18
Reference PX-P5122
Note For research use only
Molecular Constructor
Met1–Lys265 His
Product name PX-P5122-1MG
Uniprot ID P16422
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
Molecular weight 30.58 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS,pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Lys265
Protein Accession P16422
Aliases /Synonyms Epithelial glycoprotein 314, M4S1, CD326, EGP, M1S2, KSA, hEGP314, Major gastrointestinal tumor-associated protein GA733-2, EGP314, TACSTD1, Adenocarcinoma-associated antigen, TROP1, Epithelial cell adhesion molecule, EPCAM, Ep-CAM, Epithelial glycoprotein, KS 1/4 antigen, Tumor-associated calcium signal transducer 1, Cell surface glycoprotein Trop-1, GA733-2, Epithelial cell surface antigen, MIC18
Reference PX-P5122
Note For research use only
Molecular Constructor
Met1–Lys265 His

Human CD326 recombinant protein

There are no reviews yet.

Be the first to review “Human CD326 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products