Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tucotuzumab Biosimilar – Anti-EPCAM, CD326 mAb – Research Grade

  • PX-TA1182-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1-nd

Original price was: $215.00.Current price is: $167.00.

50ug 22% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Tucotuzumab Biosimilar - Anti-EPCAM, CD326 mAb - Research Grade

Product name Tucotuzumab Biosimilar - Anti-EPCAM, CD326 mAb - Research Grade
Uniprot ID P16422
Source CAS 339986-90-2
Species Humanized
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Tucotuzumab,EMD 273066,KSA-Interleukin-2,huKS-IL2,huKS1/4-IL-2,EPCAM, CD326,anti-EPCAM, CD326
Reference PX-TA1182
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name Tucotuzumab Biosimilar - Anti-EPCAM, CD326 mAb - Research Grade
Uniprot ID P16422
Source CAS 339986-90-2
Species Humanized
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Tucotuzumab,EMD 273066,KSA-Interleukin-2,huKS-IL2,huKS1/4-IL-2,EPCAM, CD326,anti-EPCAM, CD326
Reference PX-TA1182
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name PX-TA1182-50
Uniprot ID P16422
Source CAS 339986-90-2
Species Humanized
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Tucotuzumab,EMD 273066,KSA-Interleukin-2,huKS-IL2,huKS1/4-IL-2,EPCAM, CD326,anti-EPCAM, CD326
Reference PX-TA1182
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody

Introduction to Tucotuzumab Biosimilar – Anti-EPCAM, CD326 mAb

Tucotuzumab Biosimilar, also known as Anti-EPCAM or CD326 monoclonal antibody, is a promising therapeutic agent that has gained attention in the field of cancer research. This article aims to provide a comprehensive overview of the structure, activity, and potential applications of this biosimilar.

Structure of Tucotuzumab Biosimilar

Tucotuzumab Biosimilar is a monoclonal antibody that targets the epithelial cell adhesion molecule (EPCAM), also known as CD326. It is a humanized IgG1 antibody, meaning that it has been modified to reduce immunogenicity and improve its binding affinity to the target antigen. The antibody has a molecular weight of approximately 150 kDa and is composed of two heavy chains and two light chains. It has a unique Y-shaped structure, with two antigen-binding fragments (Fab) and one crystallizable fragment (Fc).

Activity of Tucotuzumab Biosimilar

Tucotuzumab Biosimilar binds specifically to the EPCAM antigen, which is overexpressed in various types of cancer, including breast, colon, lung, and pancreatic cancer. The binding of the antibody to EPCAM leads to the inhibition of cell proliferation, induction of apoptosis, and activation of the immune system. This makes Tucotuzumab Biosimilar a promising candidate for targeted cancer therapy.

In addition to its direct effects on

cancer cells, Tucotuzumab Biosimilar has been shown to enhance the efficacy of chemotherapy and radiotherapy. It does so by sensitizing cancer cells to these treatments, making them more susceptible to their effects. This is achieved through the downregulation of anti-apoptotic proteins and the upregulation of pro-apoptotic proteins in cancer cells.

Applications of Tucotuzumab Biosimilar

Tucotuzumab Biosimilar has shown promising results in preclinical and clinical trials for the treatment of various types of cancer. It has been studied in combination with chemotherapy and radiotherapy in patients with advanced or metastatic solid tumors, and has shown favorable safety and tolerability profiles.

One potential application of Tucotuzumab Biosimilar is in the treatment of triple-negative breast cancer (TNBC), a subtype of breast cancer that lacks expression of estrogen receptor, progesterone receptor, and human epidermal growth factor receptor 2 (HER2). TNBC is known to have a poor prognosis and limited treatment options. However, studies have shown that EPCAM is overexpressed in TNBC, making it a potential therapeutic target for Tucotuzumab Biosimilar.

Another potential application of Tucotuzumab Biosimilar is in the treatment of pancreatic cancer. EPCAM is highly expressed in pancreatic cancer cells, and studies have shown that Tucotuzumab Biosimilar can effectively inhibit the growth of these cells. In addition, the combination of Tucotuzumab Biosimilar with chemotherapy has shown promising results in preclinical studies, suggesting its potential as a treatment option for this aggressive form of cancer.

Conclusion

Tucotuzumab Biosimilar, also known as Anti-EPCAM or CD326 monoclonal antibody, is a promising therapeutic agent for the treatment of various types of cancer. Its unique structure and specific binding to the EPCAM antigen make it a potential targeted therapy with minimal side effects. Its ability to enhance the efficacy of chemotherapy and radiotherapy further adds to its potential as a treatment option for cancer patients. Further studies and clinical trials are needed to fully explore the potential of Tucotuzumab Biosimilar in the field of cancer therapy.

Tucotuzumab Biosimilar - Anti-EPCAM, CD326 mAb - Research Grade in ELISA Assay

Tucotuzumab Biosimilar - Anti-EPCAM, CD326 mAb - Research Grade in ELISA Assay

Tucotuzumab Biosimilar - Anti-EPCAM, CD326 mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Tucotuzumab Biosimilar - Anti-EPCAM, CD326 mAb - Research Grade

SDS-PAGE for Tucotuzumab Biosimilar - Anti-EPCAM, CD326 mAb - Research Grade

Tucotuzumab Biosimilar - Anti-EPCAM, CD326 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Tucotuzumab Biosimilar - Anti-EPCAM, CD326 mAb - Research Grade

There are no reviews yet.

Be the first to review “Tucotuzumab Biosimilar – Anti-EPCAM, CD326 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products