Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Stamulumab Biosimilar – Anti-MSTN, GDF-8 mAb – Research Grade

Isotype:
IgG1-nd

Original price was: $209.00.Current price is: $167.00.

50ug 20% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Stamulumab Biosimilar - Anti-MSTN, GDF-8 mAb - Research Grade

Product name Stamulumab Biosimilar - Anti-MSTN, GDF-8 mAb - Research Grade
Uniprot ID O14793
Source CAS 705287-60-1
Species Homo sapiens
Raw Antigen Sequence MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Stamulumab,MYO-029,MSTN, GDF-8,anti-MSTN, GDF-8
Reference PX-TA1144
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name Stamulumab Biosimilar - Anti-MSTN, GDF-8 mAb - Research Grade
Uniprot ID O14793
Source CAS 705287-60-1
Species Homo sapiens
Raw Antigen Sequence MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Stamulumab,MYO-029,MSTN, GDF-8,anti-MSTN, GDF-8
Reference PX-TA1144
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name PX-TA1144-50
Uniprot ID O14793
Source CAS 705287-60-1
Species Homo sapiens
Raw Antigen Sequence MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Stamulumab,MYO-029,MSTN, GDF-8,anti-MSTN, GDF-8
Reference PX-TA1144
Note For research use only. Not suitable for human use.
Isotype IgG1-nd

General information on Anti-MSTN/GDF-8(Homo sapiens) (Stamulumab) Monoclonal Antibody

Stamulumab is an experimental drug that inhibits myostatin and can be used to treat muscular dystrophy (MD). Myostatin is a protein that inhibits the growth of muscle tissue. Stamulumab is a recombinant human antibody targetting and inhibiting the activity of myostatin. It is a G1 immunoglobulin antibody that can bind to myostatin and prevent it from binding to its target site, thereby inhibiting the growth-limiting effect of myostatin on muscle tissue.

SDS-PAGE for Stamulumab Biosimilar - Anti-MSTN, GDF-8 mAb

SDS-PAGE for Stamulumab Biosimilar - Anti-MSTN, GDF-8 mAb

Stamulumab Biosimilar - Anti-MSTN, GDF-8 mAb, on SDS-PAGE under reducing and non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

SEC-HPLC of Stamulumab Biosimilar - Anti-MSTN;GDF8 mAb - Research Grade

SEC-HPLC of Stamulumab Biosimilar - Anti-MSTN;GDF8 mAb - Research Grade

Stamulumab Biosimilar - Anti-MSTN;GDF8 mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

Stamulumab Biosimilar - Anti-MSTN, GDF-8 mAb - Research Grade

  • Francesca Torrini, Federica Battaglia, Davide Sestaioni, Pasquale Palladino, Simona Scarano, Maria Minunni, Monoclonal antibodies (mAbs) optical detection by coupling innovative imprinted biopolymers and magnetic beads: The case of therapeutic mAb anti-myostatin detection, Sensors and Actuators B: Chemical, Volume 383, 2023, 133586, ISSN 0925-4005, https://doi.org/10.1016/j.snb.2023.133586.

There are no reviews yet.

Be the first to review “Stamulumab Biosimilar – Anti-MSTN, GDF-8 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products