Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

HuCC49 Biosimilar – Anti-FCGR1, ITGB2, TAG-72 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1-nd

Original price was: $419.00.Current price is: $308.00.

50ug 26% OFF + 308 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

HuCC49 Biosimilar - Anti-FCGR1, ITGB2, TAG-72 mAb - Research Grade

Product name HuCC49 Biosimilar - Anti-FCGR1, ITGB2, TAG-72 mAb - Research Grade
Uniprot ID TAG-72
Source CAS 823788-82-5
Species Humanized
Raw Antigen Sequence MSGPALGADGLARCPWGASTPDYAVYHDTEWGVPLRGVTALFERMSLEAFQSGLSWLVILRKREGFRRAFAGFDPETVAGFGQDDVARLLGDTGIVRNRAKIEATIRNARAVCDLAEPLDDLLWSFAPDHEGRPAPESLSDVPATTAESKAMAKELKRRGFVFVGPTTCYALMQATGMVNDHLAGCWRRAAVPVVDVSRPVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms HuCC49,H22, MDX-33,H52, Huh52,HCC49,HuCC49,FCGR1, ITGB2, TAG-72,anti-FCGR1, ITGB2, TAG-72
Reference PX-TA1137
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name HuCC49 Biosimilar - Anti-FCGR1, ITGB2, TAG-72 mAb - Research Grade
Uniprot ID TAG-72
Source CAS 823788-82-5
Species Humanized
Raw Antigen Sequence MSGPALGADGLARCPWGASTPDYAVYHDTEWGVPLRGVTALFERMSLEAFQSGLSWLVILRKREGFRRAFAGFDPETVAGFGQDDVARLLGDTGIVRNRAKIEATIRNARAVCDLAEPLDDLLWSFAPDHEGRPAPESLSDVPATTAESKAMAKELKRRGFVFVGPTTCYALMQATGMVNDHLAGCWRRAAVPVVDVSRPVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms HuCC49,H22, MDX-33,H52, Huh52,HCC49,HuCC49,FCGR1, ITGB2, TAG-72,anti-FCGR1, ITGB2, TAG-72
Reference PX-TA1137
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name PX-TA1137-50
Uniprot ID TAG-72
Source CAS 823788-82-5
Species Humanized
Raw Antigen Sequence MSGPALGADGLARCPWGASTPDYAVYHDTEWGVPLRGVTALFERMSLEAFQSGLSWLVILRKREGFRRAFAGFDPETVAGFGQDDVARLLGDTGIVRNRAKIEATIRNARAVCDLAEPLDDLLWSFAPDHEGRPAPESLSDVPATTAESKAMAKELKRRGFVFVGPTTCYALMQATGMVNDHLAGCWRRAAVPVVDVSRPVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms HuCC49,H22, MDX-33,H52, Huh52,HCC49,HuCC49,FCGR1, ITGB2, TAG-72,anti-FCGR1, ITGB2, TAG-72
Reference PX-TA1137
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody

HuCC49 Biosimilar: A Promising Antibody for Targeting FCGR1, ITGB2, and TAG-72 HuCC49 Biosimilar is a monoclonal antibody (mAb) that has gained significant attention in the field of cancer research due to its potential therapeutic applications. This biosimilar is a modified version of the original HuCC49 antibody, which was initially developed for targeting TAG-72, a tumor-associated antigen. However, the modified version of HuCC49 Biosimilar has been shown to have a broader range of activity, targeting not only TAG-72 but also two other important therapeutic targets, FCGR1 and ITGB2. In this article, we will discuss the structure, activity, and potential applications of HuCC49 Biosimilar in cancer treatment.

Structure of HuCC49 Biosimilar

HuCC49 Biosimilar is a chimeric monoclonal antibody, meaning it is composed of both human and mouse components. The variable regions of the antibody, responsible for binding to the target antigens, are derived from the mouse antibody. These regions are then fused with the constant regions of human antibodies, which are responsible for the effector functions of the antibody. This chimeric structure of HuCC49 Biosimilar allows for better recognition and binding to the target antigens, as well as improved stability and reduced immunogenicity.

Activity of HuCC49 Biosimilar

The primary activity of HuCC49 Biosimilar is its ability to bind to and target three important therapeutic targets – FCGR1, ITGB2, and TAG-72. FCGR1, also known as Fc gamma receptor 1, is a protein found on the surface of immune cells and is involved in the activation of immune responses. ITGB2, also known as integrin beta-2, is a protein involved in cell adhesion and migration. Both of these targets are overexpressed on the surface of cancer cells and have been shown to play a role in cancer progression and metastasis. By targeting these proteins, HuCC49 Biosimilar can inhibit cancer cell growth and prevent metastasis.

In addition to targeting FCGR1 and ITGB2, HuCC49 Biosimilar also binds to TAG-72, a tumor-associated antigen that is overexpressed on the surface of various types of cancer cells. This binding leads to the activation of immune responses against the cancer cells, including antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). These immune responses can effectively kill cancer cells and reduce tumor growth.

Potential Applications of HuCC49 Biosimilar

The broad range of activity of HuCC49 Biosimilar makes it a promising candidate for cancer treatment. Its ability to target multiple therapeutic targets, including FCGR1, ITGB2, and TAG-72, makes it a potential therapy for various types of cancer, such as breast, ovarian, and colorectal cancer. In preclinical studies, HuCC49 Biosimilar has shown promising results in inhibiting tumor growth and reducing metastasis in animal models.

Moreover, the chimeric structure of HuCC49 Biosimilar also makes it an attractive candidate for combination therapy. It can be combined with other targeted therapies or chemotherapeutic agents to enhance their efficacy and reduce potential side effects. The antibody-dependent immune responses activated by HuCC49 Biosimilar can also be utilized in combination with other immunotherapies, such as checkpoint inhibitors, to boost the anti-tumor immune response.

In conclusion, HuCC49 Biosimilar is a promising antibody with a unique structure and broad range of activity. Its ability to target multiple therapeutic targets and potential for combination therapy make it a potential game-changer in the field of cancer treatment. Further clinical studies are needed to fully understand the potential of this biosimilar and its role in improving cancer outcomes.

SDS-PAGE for HuCC49 Biosimilar - Anti-FCGR1; ITGB2; TAG-72 mAb - Research Grade

SDS-PAGE for HuCC49 Biosimilar - Anti-FCGR1; ITGB2; TAG-72 mAb - Research Grade

HuCC49 Biosimilar - Anti-FCGR1; ITGB2; TAG-72 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

HuCC49 Biosimilar - Anti-FCGR1, ITGB2, TAG-72 mAb - Research Grade

There are no reviews yet.

Be the first to review “HuCC49 Biosimilar – Anti-FCGR1, ITGB2, TAG-72 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products